Publikationen (Lehrstuhl)

Filterkriterien: Filter is   [Alle Filter deaktivieren]
Peschel, M. & Mammes, I. . (2022). Der Sachunterricht und die Didaktik des Sachunterrichts als besondere Herausforderung für die Professionalisierung von Grundschullehrkräften (Professionalisierung von Grundschullehrkräften. Kontext, Bedingungen und Herausforderungen). In I. Mammes & Rotter, C. (Hrsg.), Professionalisierung von Grundschullehrkräften. Kontext, Bedingungen und Herausforderungen (S. 188-203). Bad Heilbrunn: Verlag Julius Klinkhardt.
 (206.63 KB)
Haider, M. , Peschel, M. , Irion, T. , Gryl, I. , Schmeinck, D. & Brämer, M. . (2022). Die Veränderung der Lebenswelt der Kinder und ihre Folgen für Sachunterricht, Lehrkräftebildung und sachunterrichtsdidaktische Forschung (Sachunterricht in der Informationsgesellschaft). In A. Becher, Blumberg, E., Goll, T., Michalik, K. & Tenberge, C. (Hrsg.), Sachunterricht in der Informationsgesellschaft (S. 55-72). Bad Heilbrunn: Verlag Julius Klinkhardt.
 (1.04 MB)
Peschel, M. . (2022). Digital literacy – Medienbildung im Sachunterricht (Handbuch Didaktik des Sachunterrichts). In J. Kahlert, Fölling-Albers, M., Götz, M., Hartinger, A., Miller, S. & Wittkowske, S. (Hrsg.), Handbuch Didaktik des Sachunterrichts (S. 188-197). Bad Heilbrunn: Verlag Julius Klinkhardt.
Fischer, M. & Peschel, M. . (2022). Fachliche Konzepte zum Thema „Schwimmen und Sinken“ im Sachunterricht (GDSU-Journal, März 2022). In " GDSU" (Hrsg.), GDSU-Journal, März 2022 (S. 53-56). Berlin: GDSU e. V.
 (956.12 KB)
Peschel, M. , Seibert, J. & Lauer, L. . (2022). Fach-Mediales Lernen – Augmented Reality (AR) im Chemie- und Sachunterricht (Unsicherheit als Element von naturwissenschaftsbezogenen Bildungsprozessen. Gesellschaft für Didaktik der Chemie und Physik, Online-Jahrestagung 2021). In S. Habig (Hrsg.), Unsicherheit als Element von naturwissenschaftsbezogenen Bildungsprozessen. Gesellschaft für Didaktik der Chemie und Physik, Online-Jahrestagung 2021. Duisburg: Universität Duisburg-Essen.
 (400.45 KB)
Kihm, P. & Peschel, M. . (2022). Gute Aufgaben 2.0 – Aufgaben und Aufgabenkulturen im Rahmen der Digitalisierung (Sachunterricht in der Informationsgesellschaft). In A. Becher, Blumberg, E., Goll, T., Michalik, K. & Tenberge, C. (Hrsg.), Sachunterricht in der Informationsgesellschaft (S. 89-95). Bad Heilbrunn: Verlag Julius Klinkhardt.
 (855.79 KB)
Lauer, L. & Peschel, M. . (2022). Inwiefern eignen sich Augmented Reality-Technologien für den Einsatz im Sachunterricht der Primarstufe? (GDSU-Journal, März 2022). In " GDSU" (Hrsg.), GDSU-Journal, März 2022 (S. 94-96). Berlin: GDSU e. V.
 (853.29 KB)
Fischer, M. , Kunz, C. , Liebig, M. , Weber, A. & Peschel, M. . (2022). (Lebens-)Welt als Ausgangspunkt und Zieldimension des Sachunterrichts und des Anfangsunterrichts (Anfangsunterricht – Willkommen in der Schule!). In M. Gutzmann & Carle, U. (Hrsg.), Anfangsunterricht – Willkommen in der Schule! (S. 248-263). Frankfurt a. M.: Grundschulverband e. V.
Kelkel, M. & Peschel, M. . (2022). Offline- vs. Online-Formate – Eine Gegenüberstellung verschiedener Formate GOFEX-Präsentationen (GDSU-Journal, März 2022). In " GDSU" (Hrsg.), GDSU-Journal, März 2022 (S. 102-104). Berlin: GDSU e. V.
 (788.89 KB)
Peschel, M. , Gryl, I. , Straube, P. , Bach, S. , Brämer, M. & Kunkel, C. . (2022). Sachunterrichtliche Bildung in der digitalen Welt. Die digitale Transformation im Fokus der Didaktik des Sachunterrichts (Fachliche Bildung in der digitalen Welt. Digitalisierung, Big Data und KI im Forschungsfokus von 15 Fachdidaktiken). In V. Frederking & Romeike, R. (Hrsg.), Fachliche Bildung in der digitalen Welt. Digitalisierung, Big Data und KI im Forschungsfokus von 15 Fachdidaktiken (S. 359-387). Münster: Waxmann Verlag.
Kihm, P. & Peschel, M. . (2021). Aufgaben und Kulturen des Lernens. „Gute Aufgaben“ als (Ver-)Mittler einer Lehr-Lern-Kultur (Didaktik der Lernkulturen). In M. Peschel (Hrsg.), Didaktik der Lernkulturen (S. 79-103). Frankfurt a. M.: Grundschulverband e. V.
Kihm, P. & Peschel, M. . (2021). Aushandlung von Selbstbestimmung in Experimentier-Lehr-Lern-Situationen im Grundschullabor für Offenes Experimentieren (doing AGENCY) (Zentrum für Lehrerbildung (ZfL) Universität des Saarlandes. Newsletter). In Zentrum für Lehrerbildung (ZfL) Universität des Saarlandes. Newsletter (S. 6-9). Saarbrücken: Universität des Saarlandes.
 (1.01 MB)
Peschel, M. . (2021). Das Fahrrad im Sachunterricht. Ein fachübergreifendes Thema für die Grundschule (Radfahren). In Radfahren (S. 23-25). Seelze: Friedrich Verlag.
Kihm, P. & Peschel, M. . (2021). „Das habt ihr jetzt ja oft genug gemacht!“ – Einfluss von „Nonverbalitäten“ in der Lehrer*innen-Schüler*innen-Interaktion auf die Aushandlung von Selbstbestimmung beim Experimentieren (GDSU-Journal, Juli 2021). In " GDSU" (Hrsg.), GDSU-Journal, Juli 2021 (S. 24-39). Berlin: GDSU e. V.
 (158.29 KB)
Lang, V. , Seibert, J. , Eichinger, A. , Bach, S. , Kelkel, M. , Peschel, M. , et al. (2021). Das Projekt SCIENCE without FICTION innerhalb des Reality-Virtuality-Continuum (Naturwissenschaftlicher Unterricht und Lehrerbildung im Umbruch? Gesellschaft für Didaktik der Chemie und Physik. Jahrestagung in Aachen 2020). In S. Habig (Hrsg.), Naturwissenschaftlicher Unterricht und Lehrerbildung im Umbruch? Gesellschaft für Didaktik der Chemie und Physik. Jahrestagung in Aachen 2020 (S. 374-377). Regensburg: Gesellschaft für Didaktik der Chemie und Physik (GDCP).
 (984.32 KB)
Neuböck-Hubinger, B. & Peschel, M. . (2021). Das Schulbuch im Sachunterricht. Notwendige Änderungen für die Zukunft eines vielperspektivischen Sachunterrichts (Erziehung & Unterricht). In Erziehung & Unterricht (S. 703-708). Wien: Österreichischer Bundesverlag Schulbuch.
Neuböck-Hubinger, B. , Peschel, M. & Andersen, K. . (2021). Das Unterrichtsthema „Dinge im Wasser“ in österreichischen Schulbüchern des Sachunterrichts – empirische Ergebnisse (GDSU-Journal, Juli 2021). In " GDSU" (Hrsg.), GDSU-Journal, Juli 2021 (S. 107-118). Berlin: GDSU e. V.
 (107.89 KB)
Peschel, M. . (2021). Demokratie und Digitalisierung im Sachunterricht (Demokratie im Sachunterricht – Sachunterricht in der Demokratie. Beiträge zum Verhältnis von Demokratie(lernen) und Sachunterricht(sdidaktik). In T. Simon (Hrsg.), Demokratie im Sachunterricht – Sachunterricht in der Demokratie. Beiträge zum Verhältnis von Demokratie(lernen) und Sachunterricht(sdidaktik) (S. 131-145). Wiesbaden: Springer VS.
 (178.8 KB)
Kihm, P. & Peschel, M. . (2021). Demokratielernen durch Experimentieren?! – Aushandlung eines selbstbestimmten Vorgehens beim Offenen Experimentieren im Sachunterricht (Demokratie im Sachunterricht – Sachunterricht in der Demokratie. Beiträge zum Verhältnis von Demokratie(lernen) und Sachunterricht(sdidaktik). In T. Simon (Hrsg.), Demokratie im Sachunterricht – Sachunterricht in der Demokratie. Beiträge zum Verhältnis von Demokratie(lernen) und Sachunterricht(sdidaktik) (S. 197-207). Wiesbaden: Springer VS.
 (161.39 KB)
Peschel, M. . (2021). Didaktik der Lernkulturen. Frankfurt a. M.: Grundschulverband e. V.
Peschel, M. , Fischer, M. , Kihm, P. & Liebig, M. . (2021). Fragen der Kinder – Fragen der Schule – Fragen an die Sache. Die Kinder-Sachen-Welten-Frage (KSW-Frage) als Element einer neuen Lernkultur im Sinne der didaktischen Inszenierung eines vielperspektivischen Sachunterrichts (Didaktik der Lernkulturen). In M. Peschel (Hrsg.), Didaktik der Lernkulturen (S. 231-250). Frankfurt a. M.: Grundschulverband e. V.
Lauer, L. & Peschel, M. . (2021). Gestaltung von Lehr-Lernumgebungen mit Augmented Reality (AR) (Fachliche Bildung und digitale Transformation – Fachdidaktische Forschung und Diskurse. Fachtagung der Gesellschaft für Fachdidaktik 2020). In C. Maurer, Rincke, K. & Hemmer, M. (Hrsg.), Fachliche Bildung und digitale Transformation – Fachdidaktische Forschung und Diskurse. Fachtagung der Gesellschaft für Fachdidaktik 2020 (S. 64-67). Regensburg: Gesellschaft für Fachdidaktik (GFD).
 (1.17 MB)
Peschel, M. , Wedekind, H. , Kihm, P. & Kelkel, M. . (2021). Hochschullernwerkstätten und Lernwerkstätten – Verortung in didaktischen Diskursen (lern.medien.werk.statt. Hochschullernwerkstätten in der Digitalität). In B. Holub, Himpsl-Gutermann, K., Mittlböck, K., Musilek-Hofer, M., Varelija-Gerber, A. & Grünberger, N. (Hrsg.), lern.medien.werk.statt. Hochschullernwerkstätten in der Digitalität (S. 40-53). Bad Heilbrunn: Verlag Julius Klinkhardt.
 (1.5 MB)
Lauer, L. , Altmeyer, K. , Malone, S. , Barz, M. , Brünken, R. , Sonntag, D. , et al. (2021). Investigating the Usability of a Head-Mounted Display Augmented Reality Device in Elementary School Children (Sensors). In Sensors (S. 1-20).
 (2.91 MB)
Kay, C. W. , Peschel, M. , Perels, F. , Lauer, L. , Seibert, J. , Lang, V. , et al. (2021). Kompetenzentwicklung durch didaktisch eingebettete Augmented Reality (Naturwissenschaftlicher Unterricht und Lehrerbildung im Umbruch? Gesellschaft für Didaktik der Chemie und Physik. Jahrestagung in Aachen 2020). In S. Habig (Hrsg.), Naturwissenschaftlicher Unterricht und Lehrerbildung im Umbruch? Gesellschaft für Didaktik der Chemie und Physik. Jahrestagung in Aachen 2020 (S. 370-373). Regensburg: Gesellschaft für Didaktik der Chemie und Physik (GDCP).
 (890.96 KB)
Kay, C. W. , Peschel, M. , Perels, F. , Bach, S. , Kelkel, M. , Lauer, L. , et al. (2021). Kompetenzentwicklung für die Naturwissenschaften durch Augmented Reality (Naturwissenschaftlicher Unterricht und Lehrerbildung im Umbruch? Gesellschaft für Didaktik der Chemie und Physik. Jahrestagung in Aachen 2020). In S. Habig (Hrsg.), Naturwissenschaftlicher Unterricht und Lehrerbildung im Umbruch? Gesellschaft für Didaktik der Chemie und Physik. Jahrestagung in Aachen 2020 (S. 362-365). Regensburg: Gesellschaft für Didaktik der Chemie und Physik (GDCP).
 (925.76 KB)
Kihm, P. & Peschel, M. . (2021). „Komplexität wagen!“ – Methoden zur Beforschung von offenen Lehr-Lern-Prozessen in Hochschullernwerkstätten (lern.medien.werk.statt. Hochschullernwerkstätten in der Digitalität). In B. Holub, Himpsl-Gutermann, K., Mittlböck, K., Musilek-Hofer, M., Varelija-Gerber, A. & Grünberger, N. (Hrsg.), lern.medien.werk.statt. Hochschullernwerkstätten in der Digitalität (S. 70-87). Bad Heilbrunn: Verlag Julius Klinkhardt.
 (137.37 KB)
Peschel, M. . (2021). Lernkulturen und Didaktik. Etablierung einer Lern-orientierten Didaktik über den Lern- und Kulturbegriff (Didaktik der Lernkulturen). In M. Peschel (Hrsg.), Didaktik der Lernkulturen (S. 7-29). Frankfurt a. M.: Grundschulverband e. V.
Wedekind, H. , Kihm, P. & Peschel, M. . (2021). Lernwerkstattarbeit und Lernkulturen. Herausforderungen und Chancen einer Veränderung der Lernkultur durch Hochschullernwerkstätten (Didaktik der Lernkulturen). In M. Peschel (Hrsg.), Didaktik der Lernkulturen (S. 104-121). Frankfurt a. M.: Grundschulverband e. V.
Andersen, K. , Peschel, M. & Neuböck-Hubinger, B. . (2021). LiST: Bildsprache als Ausgangspunkt von Sprach- und Facharbeit im Sachunterricht – empirische Ergebnisse zu Darstellungs- und Sprachebenen in Schulbüchern (Sache und Sprache). In U. Franz, Giest, H., Haltenberger, M., Hartinger, A., Kantreiter, J. & Michalik, K. (Hrsg.), Sache und Sprache (S. 170-178). Bad Heilbrunn: Verlag Julius Klinkhardt.
Peschel, M. . (2021). Medieneinsatz und Medienentwicklung im Sachunterricht am Beispiel von (digitalen) Karten (Mythen, Widersprüche und Gewissheiten der Grundschulforschung. Eine wissenschaftliche Bestandsaufnahme nach 100 Jahren Grundschule). In N. Böhme, Dreer, B., Hahn, H., Heinecke, S., Mannhaupt, G. & Tänzer, S. (Hrsg.), Mythen, Widersprüche und Gewissheiten der Grundschulforschung. Eine wissenschaftliche Bestandsaufnahme nach 100 Jahren Grundschule (S. 187-193). Wiesbaden: Springer VS.
 (281.21 KB)
Weber, A. , Peschel, M. , Kihm, P. , Fischer, M. & Dahm, T. . (2021). Phänomene am Schulanfang. „Mit offenen Augen durch die Welt und in die Schule gehen“ (Schulstart – was Kinder jetzt brauchen). In Schulstart – was Kinder jetzt brauchen (S. 22-23). Frankfurt a. M.: Grundschulverband e. V.
 (716.07 KB)
Kelkel, M. , Peschel, M. & Kihm, P. . (2021). Potenziale der pädagogisch-didaktischen Öffnung in Hochschullernwerkstätten (lern.medien.werk.statt. Hochschullernwerkstätten in der Digitalität). In B. Holub, Himpsl-Gutermann, K., Mittlböck, K., Musilek-Hofer, M., Varelija-Gerber, A. & Grünberger, N. (Hrsg.), lern.medien.werk.statt. Hochschullernwerkstätten in der Digitalität (S. 321-334). Bad Heilbrunn: Verlag Julius Klinkhardt.
 (1.6 MB)
Eichinger, A. , Schmoll, I. , Kelkel, M. , Seibert, J. , Lauer, L. , Lang, V. , et al. (2021). QUANTAG: Augmented-Reality-Campus-Rallye als Einstieg in die Quantentechnologie (Naturwissenschaftlicher Unterricht und Lehrerbildung im Umbruch? Gesellschaft für Didaktik der Chemie und Physik. Jahrestagung in Aachen 2020). In S. Habig (Hrsg.), Naturwissenschaftlicher Unterricht und Lehrerbildung im Umbruch? Gesellschaft für Didaktik der Chemie und Physik. Jahrestagung in Aachen 2020 (S. 366-369). Regensburg: Gesellschaft für Didaktik der Chemie und Physik (GDCP).
 (951.97 KB)
Peschel, M. , Gervé, F. , Gryl, I. , Irion, T. , Schmeinck, D. & Straube, P. . (2021). Sachunterricht und Digitalisierung. Positionspapier der GDSU (2021) ( In (S. 1-19).
Peschel, M. , Neuböck-Hubinger, B. & Andersen, K. . (2021). Schwimmen oder treiben – sinken oder untergehen Die fachliche und semantische Bedeutung von Sprache im naturwissenschaftlich-orientierten Sachunterricht (Sache und Sprache). In U. Franz, Giest, H., Haltenberger, M., Hartinger, A., Kantreiter, J. & Michalik, K. (Hrsg.), Sache und Sprache (S. 63-71). Bad Heilbrunn: Verlag Julius Klinkhardt.
Lauer, L. , Peschel, M. , Seibert, J. , Lang, V. , Eichinger, A. , Altmeyer, K. , et al. (2021). Untersuchung der Wirkungen von AR-Visualisierungstechniken in der Primarstufe (Naturwissenschaftlicher Unterricht und Lehrerbildung im Umbruch? Gesellschaft für Didaktik der Chemie und Physik. Jahrestagung in Aachen 2020). In S. Habig (Hrsg.), Naturwissenschaftlicher Unterricht und Lehrerbildung im Umbruch? Gesellschaft für Didaktik der Chemie und Physik. Jahrestagung in Aachen 2020 (S. 378-381). Regensburg: Gesellschaft für Didaktik der Chemie und Physik (GDCP).
 (943.53 KB)
Seibert, J. , Marquardt, M. , Lang, V. , Lauer, L. , Peschel, M. , Perels, F. , et al. (2020). AR-MEI-SE: Augmented Reality Multitouch Experiment Instruction in Science Education (Naturwissenschaftliche Kompetenzen in der Gesellschaft von morgen. Gesellschaft für Didaktik der Chemie und Physik, Jahrestagung in Wien 2019). In S. Habig (Hrsg.), Naturwissenschaftliche Kompetenzen in der Gesellschaft von morgen. Gesellschaft für Didaktik der Chemie und Physik, Jahrestagung in Wien 2019 (S. 952-955). Duisburg: Universität Duisburg-Essen.
 (157.85 KB)
Marquardt, M. , Seibert, J. , Lauer, L. , Lang, V. , Peschel, M. & Kay, C. W. . (2020). Augmented Reality als Werkzeug zur Verknüpfung des Periodensystems der Elemente mit dem Bohr’schen Atommodell (Naturwissenschaftliche Kompetenzen in der Gesellschaft von morgen. Gesellschaft für Didaktik der Chemie und Physik, Jahrestagung in Wien 2019). In S. Habig (Hrsg.), Naturwissenschaftliche Kompetenzen in der Gesellschaft von morgen. Gesellschaft für Didaktik der Chemie und Physik, Jahrestagung in Wien 2019 (S. 948-951). Duisburg: Universität Duisburg-Essen.
 (311.6 KB)
Peschel, M. , Kay, C. W. , Lauer, L. , Seibert, J. , Marquardt, M. & Lang, V. . (2020). Augmented Reality (AR) als Werkzeug im naturwissenschaftlichen Unterricht (Naturwissenschaftliche Kompetenzen in der Gesellschaft von morgen. Gesellschaft für Didaktik der Chemie und Physik, Jahrestagung in Wien 2019). In S. Habig (Hrsg.), Naturwissenschaftliche Kompetenzen in der Gesellschaft von morgen. Gesellschaft für Didaktik der Chemie und Physik, Jahrestagung in Wien 2019 (S. 940-943). Duisburg: Universität Duisburg-Essen.
 (191.75 KB)
Lauer, L. , Peschel, M. , Marquardt, M. , Seibert, J. , Lang, V. & Kay, C. W. . (2020). Augmented Reality (AR) in der Primarstufe – Entwicklung einer AR-gestützten Lehr-Lerneinheit zum Thema Elektrik (Naturwissenschaftliche Kompetenzen in der Gesellschaft von morgen. Gesellschaft für Didaktik der Chemie und Physik, Jahrestagung in Wien 2019). In S. Habig (Hrsg.), Naturwissenschaftliche Kompetenzen in der Gesellschaft von morgen. Gesellschaft für Didaktik der Chemie und Physik, Jahrestagung in Wien 2019 (S. 944-947). Duisburg: Universität Duisburg-Essen.
 (201.25 KB)
Lang, V. , Seibert, J. , Marquardt, M. , Lauer, L. , Peschel, M. , Perels, F. , et al. (2020). Augmented Reality Lab License 2.0 (Naturwissenschaftliche Kompetenzen in der Gesellschaft von morgen. Gesellschaft für Didaktik der Chemie und Physik, Jahrestagung in Wien 2019). In S. Habig (Hrsg.), Naturwissenschaftliche Kompetenzen in der Gesellschaft von morgen. Gesellschaft für Didaktik der Chemie und Physik, Jahrestagung in Wien 2019 (S. 956-959). Duisburg: Universität Duisburg-Essen.
 (177.5 KB)
Seibert, J. , Lauer, L. , Marquardt, M. , Peschel, M. & Kay, C. W. . (2020). deAR: didaktisch eingebettete Augmented Reality (Bildung, Schule, Digitalisierung). In K. Kaspar, Becker-Mrotzek, M., Hofhues, S., König, J. & Schmeinck, D. (Hrsg.), Bildung, Schule, Digitalisierung (S. 451-456). Münster: Waxmann Verlag.
 (1.18 MB)
Kihm, P. , Rech, E. , Schmidt, R. - J. , Senzig, H. & Peschel, M. . (2020). „Digitalisierung und Schulschließungen“ in der SARS-CoV-2-Pandemie Berichtsanalyse im Zeitraum Januar bis Juli 2020 (Grundschule in und nach Corona). In Grundschule in und nach Corona (S. 29-32). Frankfurt a. M.: Grundschulverband e. V.
Bach, S. . (2020). Eine Exkursion ins Museum und ihre mediale Aufbereitung mit kidipedia. Ein Beispiel zur Förderung fachlicher und medialer Kompetenzen (Kinder lernen Zukunft. Anforderungen und tragfähige Grundlagen). In U. Hecker, Lassek, M. & Ramseger, J. (Hrsg.), Kinder lernen Zukunft. Anforderungen und tragfähige Grundlagen (S. 181-190). Frankfurt a. M.: Grundschulverband e. V.
Kihm, P. & Peschel, M. . (2020). Einflüsse von Aushandlungs- und Interaktionsprozessen auf Lernwerkstattarbeit (Spielen, Lernen, Arbeiten in Lernwerkstätten. Facetten der Kooperation und Kollaboration). In U. Stadler-Altmann, Schumacher, S., Emili, E.Angelo & Torre, E.Dalla (Hrsg.), Spielen, Lernen, Arbeiten in Lernwerkstätten. Facetten der Kooperation und Kollaboration (S. 87-99). Bad Heilbrunn: Verlag Julius Klinkhardt.
 (208.06 KB)
Kihm, P. & Töpler, M. . (2020). Grundschule aktuell – Heft 152 – Grundschule in und nach Corona. Frankfurt a. M.: Grundschulverband e. V.
Peschel, M. . (2020). Grundschulen müssen zu Schulen für JEDES Kind werden, erst dann sind sie eine Schule für ALLE Kinder! (Forum Zukunft Grundschule (2). Medienbildung – Religion(en) – Inklusive Schule). In Forum Zukunft Grundschule (2). Medienbildung – Religion(en) – Inklusive Schule (S. 2). Frankfurt a. M.: Grundschulverband e. V.
Peschel, M. & Kihm, P. . (2020). Hochschullernwerkstätten – Rollen, Rollenverständnisse und Rollenaushandlungen (Hochschullernwerkstätten – Elemente von Hochschulentwicklung? Ein Rückblick auf 15 Jahre Hochschullernwerkstatt in Halle und andernorts ). In K. Kramer, Rumpf, D., Schöps, M. & Winter, S. (Hrsg.), Hochschullernwerkstätten – Elemente von Hochschulentwicklung? Ein Rückblick auf 15 Jahre Hochschullernwerkstatt in Halle und andernorts (S. 296-310). Bad Heilbrunn: Verlag Julius Klinkhardt.
 (119.27 KB)
Bach, S. . (2020). Homeschooling – Mit kidipedia trotz Corona für die Schule lernen (Blogbeitrag im Blog der Heidelberg School of Education (HSE). Blogbeitrag im Blog der Heidelberg School of Education (HSE).
Kihm, P. & Peschel, M. . (2020). Lehr-Lern-Handeln an außerschulischen Lernorten (AL) – am Beispiel des Grundschullabors für Offenes Experimentieren (GOFEX) (Orte und Prozesse außerschulischen Lernens erforschen und weiterentwickeln. Tagungsband zur 6. Tagung Außerschulische Lernorte an der Carl von Ossietzky Universität Oldenburg vom 29.-31. August 2018). In L. Beyer, Gorr, C., Kather, C., Komorek, M., Röben, P. & Selle, S. (Hrsg.), Orte und Prozesse außerschulischen Lernens erforschen und weiterentwickeln. Tagungsband zur 6. Tagung Außerschulische Lernorte an der Carl von Ossietzky Universität Oldenburg vom 29.-31. August 2018 (S. 111-119). Münster: LIT Verlag.
Kunkel, C. & Peschel, M. . (2020). Lernen mit und über digitale Medien im Sachunterricht. Entwicklung eines vielperspektivischen Konzepts zur Erschliessung digitaler Medien (MedienPädagogik. Zeitschrift für Theorie und Praxis der Medienbildung). In MedienPädagogik. Zeitschrift für Theorie und Praxis der Medienbildung (S. 455-476).
 (1.11 MB)
Peschel, M. . (2020). Lernwerkstätten und Hochschullernwerkstätten. Begrifflichkeiten und Entwicklungen (Journal für LehrerInnenbildung (jlb). In Journal für LehrerInnenbildung (jlb) (S. 96-105). Bad Heilbrunn: Verlag Julius Klinkhardt.
 (394.84 KB)
Peschel, M. . (2020). Lernwerkstätten und Hochschullernwerkstätten. Lernwerkstätten und ihre Didaktik in der Hochschullehre. (Zusammenarbeit an der Schule). In Zusammenarbeit an der Schule (S. 34-35). Frankfurt a. M.: Grundschulverband e. V.
Lauer, L. , Peschel, M. , Bach, S. & Seibert, J. . (2020). Modellierungen Medialen Lernens (Bildung, Schule, Digitalisierung). In K. Kaspar, Becker-Mrotzek, M., Hofhues, S., König, J. & Schmeinck, D. (Hrsg.), Bildung, Schule, Digitalisierung (S. 382-387). Münster: Waxmann Verlag.
 (644.96 KB)
Kelkel, M. & Peschel, M. . (2020). Professionalisierung von Lehramtsstudierenden im GOFEX_Projektpraktikum durch Studierenden-Co-Reflexion (Spielen, Lernen, Arbeiten in Lernwerkstätten. Facetten der Kooperation und Kollaboration.). In U. Stadler-Altmann, Schumacher, S., Emili, E.Angelo & Torre, E.Dalla (Hrsg.), Spielen, Lernen, Arbeiten in Lernwerkstätten. Facetten der Kooperation und Kollaboration. (S. 64-77). Bad Heilbrunn: Verlag Julius Klinkhardt.
 (371.61 KB)
Kihm, P. , Diener, J. & Peschel, M. . (2020). Qualifizierungsprozesse und Qualifikationsarbeiten in Hochschullernwerkstätten – Forschende Entwicklung einer innovativen Didaktik (Hochschullernwerkstätten – Elemente von Hochschulentwicklung? Ein Rückblick auf 15 Jahre Hochschullernwerkstatt in Halle und andernorts ). In K. Kramer, Rumpf, D., Schöps, M. & Winter, S. (Hrsg.), Hochschullernwerkstätten – Elemente von Hochschulentwicklung? Ein Rückblick auf 15 Jahre Hochschullernwerkstatt in Halle und andernorts (S. 321-335). Bad Heilbrunn: Verlag Julius Klinkhardt.
 (123.07 KB)
Lauer, L. , Peschel, M. , Malone, S. , Altmeyer, K. , Brünken, R. , Javaheri, H. , et al. (2020). Real-time visualization of electrical circuit schematics: An augmented reality experiment setup to foster representational knowledge in introductory physics education (The Physics Teacher). In The Physics Teacher (S. 518-519).
Peschel, M. , Kihm, P. , Fischer, M. , Bützow, A. , Hoffmann, A. , Hoffmann, S. , et al. (2020). „Sachunterricht und Bildung". Eine Theorie des Sachunterrichts?! Erweiterte Rezension des Werkes von W. Köhnlein – mit Kommentaren von W. Köhnlein ( In
 (475.94 KB)
Peschel, M. . (2020). Sprache und Sache. Sprachunterricht ist auch Fachunterricht (Kinder lernen Zukunft. Über die Fächer hinaus – Prinzipien und Perspektiven). In U. Hecker, Lassek, M. & Ramseger, J. (Hrsg.), Kinder lernen Zukunft. Über die Fächer hinaus – Prinzipien und Perspektiven (S. 125-136). Frankfurt a. M.: Grundschulverband e. V.
 (1.83 MB)
Peschel, M. . (2020). Welterschließung als sachunterrichtliches Lernen mit und über digitale Medien (Digitale Bildung im Grundschulalter. Grundsatzfragen zum Primat des Pädagogischen). In M. Thumel, Kammerl, R. & Irion, T. (Hrsg.), Digitale Bildung im Grundschulalter. Grundsatzfragen zum Primat des Pädagogischen (S. 341-355). München: Kopaed Verlag.
Peschel, M. . (2019). Arme Kinder – arme Schule. Wie gerecht ist unser Bildungssystem? (Forum Zukunft Grundschule (1). Bildung – Gerechtigkeit – Demokratie). In Forum Zukunft Grundschule (1). Bildung – Gerechtigkeit – Demokratie (S. 26-29). Frankfurt a. M.: Grundschulverband e. V.
 (313.45 KB)
Huwer, J. , Lauer, L. , Dörrenbächer-Ulrich, L. , Perels, F. & Thyssen, C. . (2019). Chemie neu erleben mit Augmented Reality. Neue Möglichkeiten der individuellen Förderung (MNU Journal). In MNU Journal (S. 420-427). Neuss: Verlag Klaus Seeberger.
Peschel, M. . (2019). Digitalisierung und Demokratie (Die Grundschulzeitschrift). In Die Grundschulzeitschrift (S. 48). Seelze: Friedrich Verlag.
Kihm, P. & Peschel, M. . (2019). doing AGENCY – der Transfer von AGENCY-Elementen in Lernwerkstätten am Beispiel des Grundschullabors für Offenes Experimentieren (Perspektiven auf Hochschullernwerkstätten. Wechselspiele zwischen Individuum, Gemeinschaft, Ding und Raum). In S. Tänzer, Godau, M., Berger, M. & Mannhaupt, G. (Hrsg.), Perspektiven auf Hochschullernwerkstätten. Wechselspiele zwischen Individuum, Gemeinschaft, Ding und Raum (S. 184-188). Bad Heilbrunn: Verlag Julius Klinkhardt.
Bach, S. & Peschel, M. . (2019). Erweiterung des Medienangebotes in kidipedia – Entwicklung, Implementierung, Erprobung und Evaluation eines Mapping-Tools in Form digitaler, interaktiver Karten (Praxisforschung Sachunterricht). In M. Peschel & Carle, U. (Hrsg.), Praxisforschung Sachunterricht (S. 137-152). Baltmannsweiler: Schneider Verlag Hohengehren.
Peschel, M. & Kihm, P. . (2019). Fachliche Kompetenz der Lernbegleitung in Lernwerkstätten (Struktur und Handlung in Lernwerkstätten. Hochschuldidaktische Räume zwischen Einschränkung und Ermöglichung). In R. Baar, Feindt, A. & Trostmann, S. (Hrsg.), Struktur und Handlung in Lernwerkstätten. Hochschuldidaktische Räume zwischen Einschränkung und Ermöglichung (S. 84-95). Bad Heilbrunn: Verlag Julius Klinkhardt.
Kelkel, M. & Markus, P. . (2019). Förderung der beruflichen Handlungsfähigkeit von Studierenden im Sachunterricht durch das GOFEX_Projektpraktikum (Perspektiven auf Hochschullernwerkstätten. Wechselspiele zwischen Individuum, Gemeinschaft, Ding und Raum). In S. Tänzer, Godau, M., Berger, M. & Mannhaupt, G. (Hrsg.), Perspektiven auf Hochschullernwerkstätten. Wechselspiele zwischen Individuum, Gemeinschaft, Ding und Raum (S. 157-167). Bad Heilbrunn: Verlag Julius Klinkhardt.
Kihm, P. , Peschel, M. & Diener, J. . (2019). Kinderfragen in der Lernwerkstatt (Struktur und Handlung in Lernwerkstätten. Hochschuldidaktische Räume zwischen Einschränkung und Ermöglichung). In R. Baar, Feindt, A. & Trostmann, S. (Hrsg.), Struktur und Handlung in Lernwerkstätten. Hochschuldidaktische Räume zwischen Einschränkung und Ermöglichung (S. 109-120). Bad Heilbrunn: Verlag Julius Klinkhardt.
Peschel, M. & Diener, J. . (2019). Lehrerhandeln im Grundschullabor für Offenes Experimentieren (Praxisforschung Sachunterricht). In M. Peschel & Carle, U. (Hrsg.), Praxisforschung Sachunterricht (S. 11-34). Baltmannsweiler: Schneider Verlag Hohengehren.
Kelkel, M. & Peschel, M. . (2019). Lernwerkstätten und Schülerlabore – Unterschiedliche Konzepte, ein Verbund. Kooperation zwischen GOFEX und NanoBioLab im Rahmen des GOFEX-Projektpraktikums als Beispiel für kooperatives Lernen (Struktur und Handlung in Lernwerkstätten. Hochschuldidaktische Räume zwischen Einschränkung und Ermöglichung). In R. Baar, Feindt, A. & Trostmann, S. (Hrsg.), Struktur und Handlung in Lernwerkstätten. Hochschuldidaktische Räume zwischen Einschränkung und Ermöglichung (S. 185-189). Bad Heilbrunn: Verlag Julius Klinkhardt.
Peschel, M. . (2019). Milliarden für die Bildung. Grundlegende Forderungen an den Digitalpakt. (Die Grundschulzeitschrift). In Die Grundschulzeitschrift (S. 43). Seelze: Friedrich Verlag.
Peschel, M. & Kihm, P. . (2019). Naturwissenschaftliche Phänomene im Grundschullabor für Offenes Experimentieren (GOFEX) entdecken (Zeitschrift "Erziehung und Wissenschaft im Saarland" des Landesverbandes der GEW im DGB). In Zeitschrift "Erziehung und Wissenschaft im Saarland" des Landesverbandes der GEW im DGB (S. 14-15).
 (846.91 KB)
Peschel, M. & Carle, U. . (2019). Praxisforschung Sachunterricht. Baltmannsweiler: Schneider Verlag Hohengehren.
Peschel, M. , Carle, U. & Diener, J. . (2019). Praxisforschung Sachunterricht (Praxisforschung Sachunterricht ). In M. Peschel & Carle, U. (Hrsg.), Praxisforschung Sachunterricht (S. 5-10). Baltmannsweiler: Schneider Verlag Hohengehren.
Peschel, M. , Gervé, F. , Irion, T. , Gryl, I. & Schmeinck, D. . (2019). Sachunterricht und Digitalisierung. Positionspapier der GDSU (2019) ( In (S. 1-10). Berlin: GDSU e. V.
Peschel, M. . (2018). Digitales Lernen vs. analoges Lernen – Digitale Bildung in einer analogen Welt oder: Bildung für eine Welt mit digitalen Medien (Wozu brauchen wir digitale Medien?). In Wozu brauchen wir digitale Medien? (S. 12-15). Frankfurt a. M.: Grundschulverband e. V.
Kelkel, M. & Peschel, M. . (2018). Fachlichkeit in Lernwerkstätten (Fachlichkeit in Lernwerkstätten – Kind und Sache in Lernwerkstätten). In M. Peschel & Kelkel, M. (Hrsg.), Fachlichkeit in Lernwerkstätten – Kind und Sache in Lernwerkstätten (S. 15-34). Bad Heilbrunn: Verlag Julius Klinkhardt.
Peschel, M. & Kelkel, M. . (2018). Fachlichkeit in Lernwerkstätten. Kind und Sache in Lernwerkstätten. Bad Heilbrunn: Verlag Julius Klinkhardt.
 (7.87 MB)
Schirra, S. , Peschel, M. & Scherer, N. . (2018). „kidi on tour“ – Mobile Learning und das Potenzial digitaler Geomedien zur Vermittlung digitaler Raum-Zeitlichkeit am Beispiel von GOFEX und kidipedia (Jahrbuch Medienpädagogik 14. Der digitale Raum – Medienpädagogische Untersuchungen und Perspektiven). In M. Pietraß, Fromme, J., Grell, P. & Hug, T. (Hrsg.), Jahrbuch Medienpädagogik 14. Der digitale Raum – Medienpädagogische Untersuchungen und Perspektiven (S. 157-175). Wiesbaden: Springer VS.
 (843.24 KB)
Schirra, S. & Peschel, M. . (2018). kidipedia. Digitale Medien pädagogisch sinnvoll im Unterricht einsetzen. (EuWiS. Zeitung ‚Erziehung und Wissenschaft im Saarland’ des Landesverbandes der GEW im DGB). In EuWiS. Zeitung ‚Erziehung und Wissenschaft im Saarland’ des Landesverbandes der GEW im DGB (S. 13-14).
 (8.91 MB)
Schirra, S. & Peschel, M. . (2018). Kinder als ‚Geo-Producer’ – Kompetenzerwerb durch einen interaktiven Umgang mit digitalen Karten? (GDSU-Journal 8). In GDSU-Journal 8 (S. 90-109). Berlin: GDSU e. V.
Kihm, P. , Diener, J. & Peschel, M. . (2018). Kinder forschen – Wege zur (gemeinsamen) Erkenntnis (Fachlichkeit in Lernwerkstätten. Kind und Sache in Lernwerkstätten.). In M. Peschel & Kelkel, M. (Hrsg.), Fachlichkeit in Lernwerkstätten. Kind und Sache in Lernwerkstätten. (S. 66-84). Bad Heilbrunn: Verlag Julius Klinkhardt.
Peschel, M. . (2018). Kleines 3x3 zu Smart Kids (Digitale Bildung in der Praxis). Digitale Bildung in der Praxis.
 (2.54 MB)
Peschel, M. & Kelkel, M. . (2018). Potenziale von Lernwerkstätten zur Vermittlung von Handlungskompetenzen angehender Lehrkräfte – Chancen von Verbünden im Rahmen der Qualitätsoffensive Lehrerbildung (GDSU-Journal 8). In H. Giest, Hartinger, A. & Franz, U. (Hrsg.), GDSU-Journal 8 (S. 31-46). Berlin: GDSU e. V.
Huwer, J. , Lauer, L. , Seibert, J. , Thyssen, C. , Dörrenbächer-Ulrich, L. & Perels, F. . (2018). Re-Experiencing Chemistry with Augmented Reality: New Possibilities for Individual Support (World Journal of Chemical Education). In World Journal of Chemical Education (S. 212-217).
ValiZadeh, M. & Peschel, M. . (2018). SelfPro – Entwicklung von Selbstkonzepten beim Offenen Experimentieren (Handeln im Sachunterricht). In U. Franz, Giest, H., Hartinger, A., Heinrich-Dönges, A. & Reinhoffer, B. (Hrsg.), Handeln im Sachunterricht (S. 183-190). Bad Heilbrunn: Verlag Julius Klinkhardt.
 (8.71 MB)
Peschel, M. & Kelkel, M. . (2018). Zur Sache! (Fachlichkeit in Lernwerkstätten – Kind und Sache in Lernwerkstätten). In M. Peschel & Kelkel, M. (Hrsg.), Fachlichkeit in Lernwerkstätten – Kind und Sache in Lernwerkstätten (S. 9-14). Bad Heilbrunn: Verlag Julius Klinkhardt.
Peschel, M. , Kihm, P. , Scherer, N. & Kelkel, M. . (2017). Einstellungen zum Experimentieren im Lehramt Primarstufe (LeLa Magazin). In LeLa Magazin (S. 12-13).
 (385.46 KB)
Peschel, M. & Carle, U. . (2017). Forschung für die Praxis. Frankfurt a. M.: Grundschulverband e. V.
Carle, U. & Peschel, M. . (2017). Forschung für die Praxis – Plädoyer für schulpraktisch relevante Forschung (Forschung für die Praxis). In M. Peschel & Carle, U. (Hrsg.), Forschung für die Praxis (S. 8-19). Frankfurt a. M.: Grundschulverband e. V.
Kihm, P. & Peschel, M. . (2017). Interaktion und Kommunikation beim Experimentieren von Kindern – Eine Untersuchung über interaktions- und kommunikationsförderliche Aufgabenformate (Forschung für die Praxis). In M. Peschel & Carle, U. (Hrsg.), Forschung für die Praxis (S. 68-80). Frankfurt a. M.: Grundschulverband e. V.
Schirra, S. & Peschel, M. . (2017). Kinder kindgerecht an digitale Medien heranführen (KiTa aktuell. Fachzeitschrift für Leitungen, Fachkräfte und Träger der Kindertagesbetreuung). In KiTa aktuell. Fachzeitschrift für Leitungen, Fachkräfte und Träger der Kindertagesbetreuung (S. 112-114).
Peschel, M. & Lang, M. . (2017). Selbstkonzeptentwicklung durch Offenes Experimentieren (GDSU-Journal 7). In GDSU-Journal 7 (S. S.65-77). Berlin: GDSU e. V.
 (360.19 KB)
Peschel, M. . (2017). SelfPro: Entwicklung von Professionsverständnissen und Selbstkonzepten angehender Lehrkräfte beim Offenen Experimentieren (Profession und Disziplin – Grundschulpädagogik im Diskurs). In S. Miller, Holler-Nowitzki, B., Kottmann, B., Lesemann, S., Letmathe-Henkel, B., Meyer, N., et al. (Hrsg.), Profession und Disziplin – Grundschulpädagogik im Diskurs (S. 191-196). Wiesbaden: Springer VS.
 (282.7 KB)
Schirra, S. & Peschel, M. . (2017). Von Kids für Kids: Lernplattform kidipedia. Mediale und geografische Kompetenzen fördern (Grundschulunterricht. Sachunterricht). In Grundschulunterricht. Sachunterricht (S. 17-20).
Weber, A. . (2016). Ein Baum – Lebewesen und Lebensraum (Lernkulturen. Wie Kinder lernen können). In Lernkulturen. Wie Kinder lernen können (S. 24-28). Frankfurt a. M.: Grundschulverband e. V.
 (547.12 KB)
Peschel, M. . (2016). Energie als Perspektivenvernetzender Themenbereich im Sachunterricht (Authentizität und Lernen – das Fach in der Fachdidaktik). In C. Maurer (Hrsg.), Authentizität und Lernen – das Fach in der Fachdidaktik (S. 373-375). Regensburg: Universität Regensburg.
 (597.17 KB)
Peschel, M. . (2016). Entwicklung der selbst eingeschätzten Kompetenzen in der Sachunterrichtsausbildung im Saarland (Sachunterricht – zwischen Kompetenzorientierung, Persönlichkeitsentwicklung, Lebenswelt und Fachbezug). In H. Giest, Goll, T. & Hartinger, A. (Hrsg.), Sachunterricht – zwischen Kompetenzorientierung, Persönlichkeitsentwicklung, Lebenswelt und Fachbezug (S. 149-157). Bad Heilbrunn: Verlag Julius Klinkhardt.
Diehl, A. & Peschel, M. . (2016). (Erneuerbare) Energie im Grundschullabor für Offenes Experimentieren (Authentizität und Lernen – das Fach in der Fachdidaktik). In C. Maurer (Hrsg.), Authentizität und Lernen – das Fach in der Fachdidaktik (S. 515-517). Regensburg: Universität Regensburg.
 (563 KB)
Kelkel, M. , Peschel, M. & Urig, N. . (2016). GOFEX_EE – Erneuerbare Energien im praktischen Test (LeLa BNE Broschüre "Bildung für nachhaltige Entwicklung in Schülerlaboren"). LeLa BNE Broschüre "Bildung für nachhaltige Entwicklung in Schülerlaboren", 62-65.
Irion, T. & Peschel, M. . (2016). Grundschule und neue Medien – Neue Entwicklungen (Neue Medien in der Grundschule 2.0). In M. Peschel & Irion, T. (Hrsg.), Neue Medien in der Grundschule 2.0 (S. 11-15). Frankfurt a. M.: Grundschulverband e. V.
Peschel, M. . (2016). Inklusive Mediendidaktik in der Grundschule (Erfolgreich mit Neuen Medien! – Was bringt das Lernen im Netz?). In G.Erziehung Wissenschaft (Hrsg.), Erfolgreich mit Neuen Medien! – Was bringt das Lernen im Netz? (S. 33-36). Frankfurt a. M.: GEW.
 (646.26 KB)
Peschel, M. , Schirra, S. & Carell, S. . (2016). kidipedia – Ein Unterrichtsvorschlag (Mediales Lernen – Beispiele für eine Inklusive Mediendidaktik). In M. Peschel (Hrsg.), Mediales Lernen – Beispiele für eine Inklusive Mediendidaktik (S. 65-78). Baltmannsweiler: Schneider Verlag Hohengehren.
Peschel, M. . (2016). Lernkulturen in der Grundschule und im Sachunterricht (Lernkulturen. Wie Kinder lernen können). In Lernkulturen. Wie Kinder lernen können (S. S. 3-6). Frankfurt a. M.: Grundschulverband e. V.
 (414.61 KB)
Peschel, M. (Hrsg.). (2016). Mediales Lernen – Beispiele für eine inklusive Mediendidaktik. Baltmannsweiler: Schneider Verlag Hohengehren.
Peschel, M. . (2016). Mediales Lernen – Eine Modellierung als Einleitung (Mediales Lernen – Beispiele für eine Inklusive Mediendidaktik). In M. Peschel (Hrsg.), Mediales Lernen – Beispiele für eine Inklusive Mediendidaktik (S. 7-16). Baltmannsweiler: Schneider Verlag Hohengehren.
Peschel, M. . (2016). Medienlernen im Sachunterricht – Lernen mit Medien und Lernen über Medien (Neue Medien in der Grundschule 2.0). In M. Peschel & Irion, T. (Hrsg.), Neue Medien in der Grundschule 2.0 (S. 33-49). Frankfurt a. M.: Grundschulverband e. V.
Peschel, M. & Irion, T. (Hrsg.). (2016). Neue Medien in der Grundschule 2.0. Grundlagen – Konzepte – Perspektiven. Frankfurt a. M.: Grundschulverband e. V.
Peschel, M. . (2016). Neue Medien in der Grundschule 3.0 (Neue Medien in der Grundschule 2.0). In M. Peschel & Irion, T. (Hrsg.), Neue Medien in der Grundschule 2.0 (S. 189-192). Frankfurt a. M.: Grundschulverband e. V.
Peschel, M. . (2016). Offenes Experimentieren – Individuelles Lernen: Aufgaben in Lernwerkstätten (Paradigmen und Paradigmenwechsel in der Grundschulpädagogik). In H. Hahn, Esslinger-Hinz, I. & Panagiotopoulou, A. (Hrsg.), Paradigmen und Paradigmenwechsel in der Grundschulpädagogik (S. S. 120-131). Baltmannsweiler: Schneider Verlag Hohengehren.
 (7.26 MB)
Schirra, S. & Peschel, M. . (2016). Recherchieren, Dokumentieren und Präsentieren mit kidipedia im Zeitalter von Tablets & Co (Neue Medien in der Grundschule 2.0). In M. Peschel & Irion, T. (Hrsg.), Neue Medien in der Grundschule 2.0 (Beiträge zur Reform der Grundschule., S. 235-246). Frankfurt a. M.: Grundschulverband e. V.
Schirra, S. & Peschel, M. . (2016). Was geht? Neue Medien im Sachunterricht (Neue Medien in der Grundschule 2.0). In M. Peschel & Irion, T. (Hrsg.), Neue Medien in der Grundschule 2.0 (S. 309-315). Frankfurt a. M.: Grundschulverband e. V.
Kihm, P. , Knopf, J. & Ladel, S. . (2015). „Cu l8er – Cu2 :-)" – Was Kinder aus der SMS-Kommunikation lernen können (Grundschulunterricht Mathematik). In Grundschulunterricht Mathematik (S. 19-22). München: Oldenbourg Verlag.
Schröder, C. . (2015). Das Weltsozialforum. Bewegte Organisation oder organisierte Bewegung? (S. 280). Bielefeld: Transcript Verlag.
Carell, S. & Peschel, M. . (2015). Einfluss des Onlinelexikons kidipedia auf die Naturwissenschaftskompetenz von Jungen und Mädchen an Schweizer Primschulen (Perspektiven auf inklusive Bildung – Gemeinsam anders lehren und lernen ). In D. Blömer, Lichtblau, M., Jüttner, A.-K., Koch, K., Krüger, M. & Werning, R. (Hrsg.), Perspektiven auf inklusive Bildung – Gemeinsam anders lehren und lernen (S. 216-223). Wiesbaden: Springer VS.
 (662.42 KB)
Diehl, A. & Peschel, M. . (2015). GOFEX – Erneuerbare Energien (10 Jahre LeLa Jahrestagung – Festschrift). (L. Labor, Hrsg.)10 Jahre LeLa Jahrestagung – Festschrift, 43. Dänischenhagen: Lernort Labor.
Schirra, S. , Warken, T. & Peschel, M. . (2015). kidipedia – Einsatz eines (audio-)visuellen Bildungsmediums im geographisch-orientierten Sachunterricht (bildungsforschung). In bildungsforschung (S. 118-146).
 (3.27 MB)
Carell, S. & Peschel, M. . (2015). Kompetenzentwicklung und Interessensveränderung im Sachunterricht bei Jungen und Mädchen aus Schweizer Primarschulen durch den Einsatz eines Onlinelexikons (kidipedia) für Kinder (Bildung im und durch Sachunterricht). In H.-J. Fischer, Giest, H. & Michalik, K. (Hrsg.), Bildung im und durch Sachunterricht (S. 101-106). Bad Heilbrunn: Verlag Julius Klinkhardt.
Peschel, M. . (2015). Konzeption des Grundschullabors für Offenes Experimentieren (GOFEX) – Elemente der Öffnung (10 Jahre LeLa Jahrestagung – Festschrift). (L. Labor, Hrsg.)10 Jahre LeLa Jahrestagung – Festschrift, 122-123. Dänischenhagen: Lernort Labor.
Peschel, M. & Meiers, K. . (2015). Lesen im Sachunterricht (Sache Wort Zahl. Lehren und Lernen in der Grundschule, Heft 150-151/43). In Sache Wort Zahl. Lehren und Lernen in der Grundschule, Heft 150-151/43 (S. 60-69). Hallbergmoos: Aulis Verlag.
Peschel, M. . (2015). Medien im Sachunterricht. Unterricht gestalten – Lernkulturen entwickeln (Medienbildung). In Medienbildung (S. 10-14). Frankfurt a. M.: Grundschulverband e. V.
Peschel, M. . (2015). Medienerziehung im Sachunterricht (Handbuch Didaktik des Sachunterrichts). In J. Kahlert, Fölling-Albers, M., Götz, M., Miller, S. & Wittkowske, S. (Hrsg.), Handbuch Didaktik des Sachunterrichts (S. 173-179). Bad Heilbrunn: Verlag Julius Klinkhardt.
Peschel, M. . (2015). Offenes Experimentieren – das Projekt SelfPro (Bildung im und durch Sachunterricht). In H.-J. Fischer, Giest, H. & Michalik, K. (Hrsg.), Bildung im und durch Sachunterricht (S. 59-64). Bad Heilbrunn: Verlag Julius Klinkhardt.
Lang, M. & Peschel, M. . (2015). SINUS trifft GOFEX (10 Jahre LeLa Jahrestagung – Festschrift). (L. Labor, Hrsg.)10 Jahre LeLa Jahrestagung – Festschrift, 79. Dänischenhagen: Lernort Labor.
Peschel, M. . (2014). Außerschulische Lernorte in der Sachunterrichtsausbildung (Ausserschulische Lernorte – Impulse aus der Praxis). In D. Brovelli, Fuchs, K., Rempfler, A. & Häller, B.Sommer (Hrsg.), Ausserschulische Lernorte – Impulse aus der Praxis (S. 131-136). Münster: LIT Verlag.
Giest, H. & Peschel, M. . (2014). Editorial (GDSU-Journal). In H. Giest & Peschel, M. (Hrsg.), GDSU-Journal (S. 7-8). Berlin: GDSU e. V.
Fischer, H. - J. , Giest, H. & Peschel, M. . (2014). Editorial (Lernsituationen und Aufgabenkultur im Sachunterricht). In H.-J. Fischer, Giest, H. & Peschel, M. (Hrsg.), Lernsituationen und Aufgabenkultur im Sachunterricht (S. 9-16). Bad Heilbrunn: Verlag Julius Klinkhardt.
 (564.22 KB)
Giest, H. & Peschel, M. . (2014). GDSU-Journal Juli 2014, Heft 4. Berlin: GDSU e. V.
 (697.33 KB)
Peschel, M. . (2014). Individuelle Förderung beim naturwissenschaftlichen Lernen im Sachunterricht der Grundschule. In (S. 146-160). Bad Heilbrunn: Verlag Julius Klinkhardt.
Carell, S. & Peschel, M. . (2014). kidipedia – Ergebnisse eines Forschungsprojekts im Sachunterricht (Naturwissenschaftliche Bildung zwischen Science- und Fachunterricht.). In S. Bernholt (Hrsg.), Naturwissenschaftliche Bildung zwischen Science- und Fachunterricht. (S. 489-491). Kiel: IPN.
 (1.34 MB)
Peschel, M. & Koch, A. . (2014). Lehrertypen – Typisch Lehrer?! Clusterungen im Projekt SUN (Naturwissenschaftliche Bildung zwischen Science- und Fachunterricht.). In S. Bernholt (Hrsg.), Naturwissenschaftliche Bildung zwischen Science- und Fachunterricht. (S. 216-218). Kiel: IPN.
 (1.27 MB)
Peschel, M. . (2014). Lernen mit und über Medien – Mediales Lernen im neuen Perspektivrahmen (Grundschulmagazin). In Grundschulmagazin (S. 26-30). München: Oldenbourg Verlag.
Hildebrandt, E. , Peschel, M. & Weißhaupt, M. . (2014). Lernen zwischen freiem und instruiertem Tätigsein. Bad Heilbrunn: Verlag Julius Klinkhardt.
 (1.76 MB)
Hildebrandt, E. , Peschel, M. & Weißhaupt, M. . (2014). Lernen zwischen freiem und instruiertem Tätigsein – eine Einführung (Lernen zwischen freiem und instruiertem Tätigsein). In E. Hildebrandt, Peschel, M. & Weißhaupt, M. (Hrsg.), Lernen zwischen freiem und instruiertem Tätigsein (S. 9-13). Bad Heilbrunn: Verlag Julius Klinkhardt.
 (55.86 KB)
Fischer, H. Joachim, Giest, H. & Peschel, M. . (2014). Lernsituationen und Aufgabenkultur im Sachunterricht. Bad Heilbrunn: Verlag Julius Klinkhardt.
Peschel, M. . (2014). Medienerziehung (Sachunterricht – Didaktik für die Grundschule). In A. Hartinger & Lange, K. (Hrsg.), Sachunterricht – Didaktik für die Grundschule (S. 158-169). Berlin: Cornelsen Scriptor Verlag.
Carell, S. & Peschel, M. . (2014). Motivations- und Interessenveränderungen bei der Arbeit mit (Lernsituationen und Aufgabenkultur im Sachunterricht). In H.-J. Fischer, Giest, H. & Peschel, M. (Hrsg.), Lernsituationen und Aufgabenkultur im Sachunterricht (S. 79-86). Bad Heilbrunn: Verlag Julius Klinkhardt.
Czepukojc, B. , Baltes, A. - K. , Kelkel, M. , Cerella, C. , Viswanathan, U. Maheswari, Salm, F. , et al. (2014). Towards pharmaceutically useful, redox-modulating polysulfanes based on naturally occurring garlic compounds (Food and Chemical Toxicology). In Food and Chemical Toxicology (S. 249-257).
Peschel, M. . (2014). Vom instruierten zum Freien Forschen – Selbstbestimmungskonzepte im GOFEX (Lernen zwischen freiem und instruiertem Tätigsein). In E. Hildebrandt, Peschel, M. & Weißhaupt, M. (Hrsg.), Lernen zwischen freiem und instruiertem Tätigsein (S. 67-79). Bad Heilbrunn: Verlag Julius Klinkhardt.
 (109.44 KB)
 (735.13 KB)
Kelkel, M. & Peschel, M. . (2014). Wer macht die Nacht? – Das Phänomen Nacht naturwissenschaftlich erkunden (kindergarten heute). In kindergarten heute (S. 32-34). Freiburg i. Br.: Verlag Herder.
Peschel, M. , Favre, P. & Mathis, C. . (2013). Einleitung (SaCHen unterriCHten – Beiträge zur Situation der Sachunterrichtsdidaktik in der deutschsprachigen Schweiz). In M. Peschel, Favre, P. & Mathis, C. (Hrsg.), SaCHen unterriCHten – Beiträge zur Situation der Sachunterrichtsdidaktik in der deutschsprachigen Schweiz (Dimensionen des Sachunterrichts – Kinder.Sachen.Welten., S. 5-6). Baltmannsweiler: Schneider Verlag Hohengehren.
Peschel, M. & Carell, S. . (2013). Entwicklungen in der Medienpädagogik von Mosaik (1992/1993) zu kidipedia (2012) – zukunftsfähige Konzeption für den Sachunterricht? (Der Sachunterricht und seine Didaktik – Bestände prüfen und Perspektiven entwickeln). In H.-J. Fischer, Giest, H. & Pech, D. (Hrsg.), Der Sachunterricht und seine Didaktik – Bestände prüfen und Perspektiven entwickeln (S. 121-128). Bad Heilbrunn: Verlag Julius Klinkhardt.
Schumacher, A. & Peschel, M. . (2013). Forschendes Lernen im Grundschullabor für Offenes Experimentieren (GOFEX) (Inquiry-based learning – Forschendes Lernen. Gesellschaft für Didaktik der Chemie und Physik, Jahrestagung in Hannover 2012.). In S. Bernholt (Hrsg.), Inquiry-based learning – Forschendes Lernen. Gesellschaft für Didaktik der Chemie und Physik, Jahrestagung in Hannover 2012. (S. 545-547). Kiel: IPN.
 (919.59 KB)
Carell, S. & Peschel, M. . (2013). Forschendes Lernen im Web 2.0 – kidipedia (Inquiry-based learning – Forschendes Lernen. Gesellschaft für Didaktik der Chemie und Physik). In S. Bernholt (Hrsg.), Inquiry-based learning – Forschendes Lernen. Gesellschaft für Didaktik der Chemie und Physik (S. 560–562). Kiel: IPN.
 (785.23 KB)
Peschel, M. , Köster, H. & Zimmermann, M. . (2013). Forschendes Lernen in der Frühpädagogik und im Sachunterricht (Inquiry-based learning – Forschendes Lernen. Gesellschaft für Didaktik der Chemie und Physik, Jahrestagung in Hannover 2012.). In S. Bernhold (Hrsg.), Inquiry-based learning – Forschendes Lernen. Gesellschaft für Didaktik der Chemie und Physik, Jahrestagung in Hannover 2012. (S. 542-544). Kiel: IPN.
 (693.6 KB)
Peschel, M. . (2013). GOFEX – Ort des Lehrens und Lernens (4-12-jährige – Ihre schulischen und außerschulischen Lern- und Lebenswelten). In E. Wannack, Bosshart, S., Eichenberger, A., Fuchs, M., Hardegger, E. & Marti, S. (Hrsg.), 4-12-jährige – Ihre schulischen und außerschulischen Lern- und Lebenswelten (S. 260-268). Münster: Waxmann Verlag.
 (1.81 MB)
Peschel, M. & Schumacher, A. . (2013). Grundschullabor für Offenes Experimentieren – Lehr- und Lernort für Schülerinnen und Schüler, Studierende und Lehrpersonen (Studieren in Lernwerkstätten. Potentiale und Herausforderungen für die Lehrerbildung). In H. Coelen & Müller-Naendrup, B. (Hrsg.), Studieren in Lernwerkstätten. Potentiale und Herausforderungen für die Lehrerbildung (S. 85-91). Wiesbaden: Springer VS.
 (1.23 MB)
Peschel, M. . (2013). Gute Aufgaben für forschendes Lernen im experimentierenden Sachunterricht (Inquiry-based learning – Forschendes Lernen. Gesellschaft für Didaktik der Chemie und Physik, Jahrestagung Hannover 2012). In S. Bernholt (Hrsg.), Inquiry-based learning – Forschendes Lernen. Gesellschaft für Didaktik der Chemie und Physik, Jahrestagung Hannover 2012 (S. 128-130). Kiel: IPN.
 (697.91 KB)
Gervé, F. & Peschel, M. . (2013). Medien im Sachunterricht (Sachunterricht in der Grundschule). In E. Gläser & Schönknecht, G. (Hrsg.), Sachunterricht in der Grundschule (S. 58-79). Frankfurt a. M.: Arbeitskreis Grundschule – Der Grundschulverband.
Peschel, M. . (2013). Perspektivenvernetzender Themenbereich Medien (Perspektivrahmen Sachunterricht). In Perspektivrahmen Sachunterricht (S. 83–85). Bad Heilbrunn: Verlag Julius Klinkhardt.
Schröder, C. . (2013). Politische Umbrüche und Soziale Arbeit in der Maghreb-Maschrek-Region (Weltatlas Sozialen Arbeit – Jenseits aller Vermessungen). In Weltatlas Sozialen Arbeit – Jenseits aller Vermessungen (S. 32-51). Weinheim: Beltz Juventa Verlag.
Schröder, C. . (2013). Quién define lo que es el FSM? . In (Foro Social Mundial: ¿Momento de replanteamientos?).
 (861.14 KB)
Peschel, M. , Favre, P. & Mathis, C. . (2013). SaCHen unterriCHten – Beiträge zur Situation der Sachunterrichtsdidaktik in der deutschsprachigen Schweiz. Baltmannsweiler: Schneider Verlag Hohengehren.
Peschel, M. , Favre, P. & Mathis, C. . (2013). Sachunterricht im Wandel (SaCHen unterriCHten – Beiträge zur Situation der Sachunterrichtsdidaktik in der deutschsprachigen Schweiz). In M. Peschel, Favre, P. & Mathis, C. (Hrsg.), SaCHen unterriCHten – Beiträge zur Situation der Sachunterrichtsdidaktik in der deutschsprachigen Schweiz (S. 7-20). Baltmannsweiler: Schneider Verlag Hohengehren.
Mathis, C. & Peschel, M. . (2013). Sachunterrichtsstudium für die Vorschul-/Primarstufe an der Pädagogischen Hochschule FHNW (SaCHen unterriCHten – Beiträge zur Situation der Sachunterrichtsdidaktik in der deutschsprachigen Schweiz). In M. Peschel, Favre, P. & Mathis, C. (Hrsg.), SaCHen unterriCHten – Beiträge zur Situation der Sachunterrichtsdidaktik in der deutschsprachigen Schweiz (S. 67-82). Baltmannsweiler: Schneider Verlag Hohengehren.
Czepukojc, B. , Baltes, A. - K. , Cerella, C. , Kelkel, M. , Viswanathan, U. Maheswari, Salm, F. , et al. (2013). Synthetic polysulfane derivatives induce cell cycle arrest and apoptotic cell death in human hematopoietic cancer cells (Food and chemical toxicology: an international journal published for the British Industrial Biological Research Association 64). In Food and chemical toxicology: an international journal published for the British Industrial Biological Research Association 64.
 (1.23 MB)
Schröder, C. & Homfeldt, H. Günther. (2013). Transnationales Wissen in NGOs (Transnationales Wissen und Soziale Arbeit). In Transnationales Wissen und Soziale Arbeit. Weinheim: Beltz Juventa Verlag.
Peschel, M. . (2013). Vergleichen und Recherchieren (Perspektivrahmen Sachunterricht). In (Hrsg.), Perspektivrahmen Sachunterricht (S. 148–152). Bad Heilbrunn: Verlag Julius Klinkhardt.
Bähr, C. , Homfeldt, H. Günther, Schröder, C. , Schröer, W. & Schweppe, C. . (2013). Weltatlas Sozialen Arbeit – Jenseits aller Vermessungen. Weinheim: Beltz Juventa Verlag.
Schröder, C. . (2013). Who defines what the World Social Forum is?. In (Foro Social Mundial: ¿Momento de replanteamientos?).
 (128.25 KB)
Peschel, M. . (2012). Dann musst Du am Automaten neues Geld kaufen! – Wie funktioniert eigentlich ein Automat? Eine Frage, die nicht nur Kinder interessiert (Fachzeitschrift für Kindergarten und Unterstufe,). In Fachzeitschrift für Kindergarten und Unterstufe, (S. 27-30).
 (624.31 KB)
Carell, S. & Peschel, M. . (2012). Die Internetplattform kidipedia im Unterricht sinnvoll nutzen (GDSU-Journal). In " GDSU" (Hrsg.), GDSU-Journal (S. 57-66).
 (136.3 KB)
Peschel, M. . (2012). Gute Aufgaben im Sachunterricht – Offene Werkstätten = Gute Aufgaben? (Aufgabenqualität in der Grundschule). In U. Carle & Kosinar, J. (Hrsg.), Aufgabenqualität in der Grundschule (S. 161-172). Baltmannsweiler: Schneider Verlag Hohengehren.
 (1.84 MB)
Peschel, M. & Carell, S. . (2012). Kidipedia – Unterstützungsangebot für Mädchen & Jungen im Sachunterricht (Konzepte fachdidaktischer Strukturierung für den Unterricht ). In S. Bernholt (Hrsg.), Konzepte fachdidaktischer Strukturierung für den Unterricht (S. S. 464-467). Münster: LIT Verlag.
Peschel, M. . (2012). Mediendidaktik, Medienkompetenz, Medienerziehung – Web 2.0 Aktivitäten im Sachunterricht (GDSU-Journal). In " GDSU" (Hrsg.), GDSU-Journal (S. 67-79).
 (86.21 KB)
Peschel, M. & Schumacher, A. . (2012). Neue Wege beim Experimentieren (Schulblatt der Kantone Aargau und Solothurn). Schulblatt der Kantone Aargau und Solothurn.
Peschel, M. & Streit, C. . (2012). Physik und Mathe können lustvoll gelernt werden. Bildungsseite der Aargauer Zeitung und der Basler Zeitung.
Kelkel, M. , Cerella, C. , Mack, F. , Schneider, T. , Jacob, C. , Schumacher, M. , et al. (2012). ROS-independent JNK activation and multisite phosphorylation of Bcl-2 link diallyl tetrasulfide-induced mitotic arrest to apoptosis (Carcinogenesis). In Carcinogenesis (S. 2162-2171).
 (2.44 MB)
Kelkel, M. , Schumacher, M. , Dicato, M. & Diederich, M. F. . (2011). Antioxidant and anti-proliferative properties of lycopene (Free Radical Research). In Free Radical Research (S. 925-940). 10.3109/10715762.2011.564168
 (447.21 KB)
Peschel, M. . (2011). Der Lernstick und die Schulfächer – Versuch einer Übersicht (mLearning in der Schule. Der Lernstick als Lerninstrument). In H.-U. Grunder (Hrsg.), mLearning in der Schule. Der Lernstick als Lerninstrument (S. 51-72). Baltmannsweiler: Schneider Verlag Hohengehren.
Schumacher, M. , Kelkel, M. , Dicato, M. & Diederich, M. F. . (2011). Gold from the sea: Marine compounds as inhibitors of the hallmarks of cancer (Biotechnology Advances). In Biotechnology Advances (S. 531-547).
 (1.92 MB)
Peschel, M. . (2011). kidipedia – Ein Onlinelexikon von Kids für Kids (Sachunterricht – auf dem Weg zur Inklusion). In H. Giest, Kaiser, A. & Schomaker, C. (Hrsg.), Sachunterricht – auf dem Weg zur Inklusion (S. 193-198). Bad Heilbrunn: Verlag Julius Klinkhardt.
 (373.11 KB)
Peschel, M. & Streit, C. . (2011). Lern-Atelier in Solothurn eröffnet (Schulblatt der Kantone Aargau und Solothurn). Schulblatt der Kantone Aargau und Solothurn.
Peschel, M. . (2011). Macht der Mond die Nacht? – Tag und Nacht im Kindergarten (Weltwissen Sachunterricht). In Weltwissen Sachunterricht (S. 6-7). Braunschweig: Westermann Verlag.
 (1.09 MB)
Peschel, M. . (2011). Medienerziehung und schulische Sozialerziehung (Sozialerziehung in der Schule). In M. Limbourg & Steins, G. (Hrsg.), Sozialerziehung in der Schule (S. 451-474). Wiesbaden: VS Verlag für Sozialwissenschaften.
Schröder, C. . (2011). “Mit vereinten Kräften voran”. Social Development in einem Kooperationsprojekt einer transnationaeln NGO und einer loken NGO (Soziale Arbeit als Entwicklungszusammenarbeit). In Soziale Arbeit als Entwicklungszusammenarbeit. Baltmannsweiler: Schneider Verlag Hohengehren.
Cerella, C. , Kelkel, M. , Viry, E. , Dicato, M. , Jacob, C. & Diederich, M. F. . (2011). Naturally Occurring Organic Sulfur Compounds: An Example of a Multitasking Class of Phytochemicals in Anti-Cancer Research (Phytochemcials). In Phytochemcials.
 (711.62 KB)
Schröder, C. . (2011). Researching the World Social Forum. My First Steps into the Field (Transnational Social Review). In Transnational Social Review.
 (398.73 KB)
Schneider, T. , Baldauf, A. , Schneider, M. , Burkholz, T. , Kelkel, M. & Jacob, C. . (2011). Selective Antimicrobial Activity Associated with Sulfur Nanoparticles (Journal of Biomedical Nanotechnology). In Journal of Biomedical Nanotechnology (S. 395405).
 (1.28 MB)
Schumacher, M. , Kelkel, M. , Dicato, M. & Diederich, M. F. . (2011). A Survey of Marine Natural Compounds and Their Derivatives with Anti-Cancer Activity Reported in 2010 (molecules). In molecules (S. 5629-5646).
 (2.1 MB)
Peschel, M. . (2011). Wege zum Offenen Experimentieren (Wissenschaft trifft Praxis – Bericht von der Expertentagung zur frühen naturwissenschaftlichen Bildung). (K. Scheler, Hrsg.)Wissenschaft trifft Praxis – Bericht von der Expertentagung zur frühen naturwissenschaftlichen Bildung, Forscherstation – Heidelberg, 48-54.
Kelkel, M. , Boyer-Orlikova, B. & Diederich, M. F. . (2010). Decrypting the labyrinth of inflammatory cell signaling pathways: Editorial to the meeting "Inflammation 2010" (Journal of Cell Communication and Signaling 4(4). In Journal of Cell Communication and Signaling 4(4) (S. 159-60).
 (67.68 KB)
Peschel, M. , Weißer, P. & Schäfer, J. . (2010). Der Zucker nimmt die Tinte Huckepack – Kooperationen zwischen Schule und Universität (Sache – Wort – Zahl (SWZ). In Sache – Wort – Zahl (SWZ) (Heft 112, 09/2010, 38. Jhg., S. 48-56). Hallbergmoos: Aulis Verlag.
 (1.55 MB)
Peschel, M. & Struzyna, S. . (2010). GOFEX – Grundschullabor für Offenes Experimentieren: Entwicklung eines Raumkonzeptes als Element der Öffnung (Zwischen Fachdidaktik und Stufendidaktik. Perspektiven für die Grundschulforschung). In K.-H. Arnold, Hauenschild, K., Schmidt, B. & Ziegenmeyer, B. (Hrsg.), Zwischen Fachdidaktik und Stufendidaktik. Perspektiven für die Grundschulforschung (S. 197-200). Wiesbaden: VS Verlag für Sozialwissenschaften.
 (1.52 MB)
Peschel, M. & Carell, S. . (2010). Grundschullabor für Offenes Experimentieren. Das Materialkonzept. (Entwicklung naturwissenschaftlichen Denkens zwischen Phänomen und Systematik). In D. Höttecke (Hrsg.), Entwicklung naturwissenschaftlichen Denkens zwischen Phänomen und Systematik (S. 461-463). Münster: LIT Verlag.
 (5.36 MB)
Peschel, M. . (2010). Grundschullabor für Offenes Experimentieren – Grundschultransfer? (Anschlussfähige Bildung im Sachunterricht). In H. Giest & Pech, D. (Hrsg.), Anschlussfähige Bildung im Sachunterricht (S. 49-57). Bad Heilbrunn: Verlag Julius Klinkhardt.
 (9.28 MB)
Peschel, M. . (2010). kidipedia – Präsentieren von Sachunterrichtsergebnissen im Internet (Neue Medien im Sachunterricht). In M. Peschel (Hrsg.), Neue Medien im Sachunterricht (S. 71-78). Baltmannsweiler: Schneider Verlag Hohengehren.
 (706.07 KB)
Peschel, M. . (2010). kidipedia – Untersuchung der Machbarkeit einer neuartigen Online-Plattform (Arbeitspapiere der Hans-Böckler-Stiftung). Arbeitspapiere der Hans-Böckler-Stiftung. Düsseldorf: Setzkasten.
 (4.34 MB)
Peschel, M. . (2010). – Eine Präsentationsplattform im Internet für Sachunterrichtsergebnisse (Zwischen Fachdidaktik und Stufendidaktik. Perspektiven für die Grundschulforschung). In K.-H. Arnold, Hauenschild, K., Schmidt, B. & Ziegenmeyer, B. (Hrsg.), Zwischen Fachdidaktik und Stufendidaktik. Perspektiven für die Grundschulforschung (S. 193-196). Wiesbaden: VS Verlag für Sozialwissenschaften.
Peschel, M. & Struzyna, S. . (2010). Konzeption eines Grundschullabors für Offenes Experimentieren (GOFEX). Der Raum als Element der Öffnung. (Entwicklung naturwissenschaftlichen Denkens zwischen Phänomen und Systematik). In D. Höttecke (Hrsg.), Entwicklung naturwissenschaftlichen Denkens zwischen Phänomen und Systematik (S. 458-460). Münster: LIT Verlag.
 (4.36 MB)
Peschel, M. . (2010). Luft und Vakuum. Experimente mit Luft .. und ohne! (Sache – Wort – Zahl (SWZ). In Sache – Wort – Zahl (SWZ) (S. 23-25). Hallbergmoos: Aulis Verlag.
 (748.87 KB)
Peschel, M. & Herrmann, C. . (2010). Materialaspekt im Sachunterricht – Einflüsse des Materials auf die physikalischen Anteile des Sachunterrichts (Entwicklung naturwissenschaftlichen Denkens zwischen Phänomen und Systematik). In D. Höttecke (Hrsg.), Entwicklung naturwissenschaftlichen Denkens zwischen Phänomen und Systematik (S. 455-457). Münster: LIT Verlag.
Peschel, M. . (2010). Neue Medien im Sachunterricht. Gestern – Heute – Morgen. Baltmannsweiler: Schneider Verlag Hohengehren.
Peschel, M. . (2010). Neue Medien in Forschung und Praxis. Ergebnisse aus der Arbeitsgruppe Neue Medien (ICT) im Sachunterricht der GDSU (Weltwissen Sachunterricht). In Weltwissen Sachunterricht (S. 54).
 (228.35 KB)
Peschel, M. & Carell, S. . (2010). Nutzungsweise computergestützter Medien – Unterschiede zwischen Jungen und Mädchen?! (Neue Medien im Sachunterricht). In Neue Medien im Sachunterricht (S. 79-86). Baltmannsweiler: Schneider Verlag Hohengehren.
Kelkel, M. , Jacob, C. , Dicato, M. & Diederich, M. F. . (2010). Potential of the Dietary Antioxidants Resveratrol and Curcumin in Prevention and Treatment of Hematologic Malignancie (Molecules). In Molecules (S. 7035-7074).
 (792.79 KB)
Peschel, M. . (2009). Alleine geht es gut, zusammen manchmal besser! – Kooperationen im Sachunterricht beim Experimentieren (Sache – Wort – Zahl (SWZ). In Sache – Wort – Zahl (SWZ) (S. 23-27). Hallbergmoos: Aulis Verlag.
 (7.55 MB)
Peschel, M. . (2009). Aus- und Fortbildungen für den naturwissenschaftlich-physikalischen Sachunterricht (Lernen und kindliche Entwicklung). In R. Lauterbach, Giest, H. & Marquardt-Mau, B. (Hrsg.), Lernen und kindliche Entwicklung (S. 149-156). Bad Heilbrunn: Verlag Julius Klinkhardt.
Peschel, M. . (2009). Der Begriff der Offenheit beim Offenen Experimentieren (Chemie- und Physikdidaktik für die Lehramtsausbildung). In D. Höttecke (Hrsg.), Chemie- und Physikdidaktik für die Lehramtsausbildung (S. 268-270). Münster: LIT Verlag.
 (3.82 MB)
Peschel, M. . (2009). GOFEX – Grundschullabor für Offenes Experimentieren. Grundlegende Konzeption (Lernen und kindliche Entwicklung). In R. Lauterbach, Giest, H. & Marquardt-Mau, B. (Hrsg.), Lernen und kindliche Entwicklung (S. 229-236). Bad Heilbrunn: Verlag Julius Klinkhardt.
 (528.97 KB)
Peschel, M. . (2009). Naturwissenschaftliche Aus- und Fortbildung für den Sachunterricht – Ergebnisse aus dem Projekt SUN zum physikbezogenen Sachunterricht (Chemie- und Physikdidaktik für die Lehramtsausbildung). In D. Höttecke (Hrsg.), Chemie- und Physikdidaktik für die Lehramtsausbildung (S. 143-145). Münster: LIT Verlag.
Peschel, M. . (2009). Rezension zu Hössl, Alfred, Vossler, Andreas: Bildungsverläufe in der Grundschule. Klinkhardt 2006.. EWR 8 (2009), Nr. 1 (Veröffentlicht am 15.01.2009).
Peschel, M. & Giest, H. . (2009). Spielen am Computer – Chancen für den Sachunterricht (Grundschulunterricht – Sachunterricht). In Grundschulunterricht – Sachunterricht (S. 33-37). München: Oldenbourg Verlag.
 (989.62 KB)
Peschel, M. & Bürger, C. . (2009). Unterrichtsbedingungen für physikalischen Sachunterricht (SUN) (Chemie- und Physikdidaktik für die Lehramtsausbildung). In D. Höttecke (Hrsg.), Chemie- und Physikdidaktik für die Lehramtsausbildung (S. 428-430). Münster: LIT Verlag.
Peschel, M. . (2008). GOFEX – Grundschullabor für Offenes Experimentieren (Didaktik der Physik). In Didaktik der Physik. Berlin: Lehmanns Media.
Peschel, M. . (2008). kidipedia – Ein Wikipedia für Kids (Zentrum für Lehrerbildung Essen: Fachdidaktische Forschung – Empirische Lehr-Lern-Forschung). Zentrum für Lehrerbildung Essen: Fachdidaktische Forschung – Empirische Lehr-Lern-Forschung, 70-72.
Peschel, M. . (2008). Offenes Experimentieren – Chancen für Jungen und Mädchen! (Chancengleichheit in der Grundschule. Ursachen und Wege aus der Krise). In J. Ramsberger & Ramsberger, W. (Hrsg.), Chancengleichheit in der Grundschule. Ursachen und Wege aus der Krise. Wiesbaden: VS Verlag für Sozialwissenschaften.
 (88.68 KB)
Peschel, M. & Gabriel, P. . (2008). Profilklasse Naturwissenschaftlicher Unterricht – Eine Kooperation der Universität Duisburg-Essen mit dem Max-Planck-Gymnasium Duisburg (Didaktik der Physik). In Didaktik der Physik. Berlin: Lehmanns Media.
Peschel, M. . (2008). Schriftanlässe – Kommunikation im Schriftspracherwerb (Grundschule Deutsch). In Grundschule Deutsch. München: Oldenbourg Verlag.
 (5.57 MB)
Peschel, M. . (2008). SUN: Erhebung der Lehrvoraussetzungen und des Professionswissens von Lehrenden im Sachunterricht der Grundschule (Zentrum für Lehrerbildung Essen: Fachdidaktische Forschung – Empirische Lehr-Lern-Forschung). Zentrum für Lehrerbildung Essen: Fachdidaktische Forschung – Empirische Lehr-Lern-Forschung, 68-70.
Gebauer, M. & Peschel, M. . (2007). Duden: Sachunterricht 4. Ausgabe Thüringen.
Gebauer, M. & Peschel, M. . (2007). Duden: Sachunterricht. Ausgabe Sachsen-Anhalt.
Peschel, M. . (2007). Konzeption einer Studie zu den Lehrvoraussetzungen und dem Professionswissen von Lehrenden im Sachunterricht der Grundschule in NRW. Das Projekt SUN (Kompetenzerwerb im Sachunterricht fördern und erfassen). In R. Lauterbach, Hartinger, A., Feige, B. & Cech, D. (Hrsg.), Kompetenzerwerb im Sachunterricht fördern und erfassen (S. 151-160). Bad Heilbrunn: Verlag Julius Klinkhardt.
 (713.99 KB)
Peschel, M. & Gabriel, P. . (2007). Naturwissenschaftliche Profilklasse – Eine Kooperation zwischen der Universität Duisburg-Essen und dem MPG-Duisburg (Didaktik der Physik). In Didaktik der Physik. Berlin: Lehmanns Media.
Peschel, M. . (2007). Sinne. In: M. Gebauer & M. Peschel (Hrsg.): Duden: Sachunterricht 4. Ausgabe Thüringen. (M. Gebauer & Peschel, M., Hrsg.).
Peschel, M. & Struzyna, S. . (2007). Wer unterrichtet unsere Kinder? SUN – Sachunterricht in Nordrhein-Westfalen (Qualität von Grundschulunterricht entwickeln, erfassen und bewerten). In K. möller, Hanke, P., Beinbrech, C., Hein, A., Kleickmann, T. & Schages, R. (Hrsg.), Qualität von Grundschulunterricht entwickeln, erfassen und bewerten (S. 171-174). Bonn: Verlag für Sozialwissenschaften.
 (111.99 KB)
Peschel, M. . (2006). Das Mobile Computerlabor. Konzeption und Anwendungen. (Didaktik der Physik Kassel). In V. Nordmeier & Oberländer, A. (Hrsg.), Didaktik der Physik Kassel. Berlin: Lehmanns Media.
Peschel, M. . (2006). Der Computer zur Präsentation von Experimenten im Sachunterricht (Zeitschrift Grundschulunterricht). In Zeitschrift Grundschulunterricht (S. S. 31-34). München: Oldenbourg Verlag.
Peschel, M. . (2006). LDS im Werkstattunterricht. Defintion und Abgrenzung (Professionelles Handeln in der Grundschule). In R. Hinz & Pütz, T. (Hrsg.), Professionelles Handeln in der Grundschule (Entwicklungslinien der Grundschulpädagogik., S. 159-166). Baltmannsweiler: Schneider Verlag Hohengehren.
Peschel, M. . (2006). Lehrvoraussetzungen und Professionswissen von Lehrenden im Sachunterricht der Grundschule (Fachdidaktische Forschung – Empirische Lehr-Lern-Forschung. Essen). (A. Pitton, Hrsg.)Fachdidaktische Forschung – Empirische Lehr-Lern-Forschung. Essen, 88 ff.
Peschel, M. . (2006). Sachunterricht und Lautorientierter Schriftspracherwerb (Auf den Anfang kommt es an: Kompetenzen entwickeln – Kompetenzen stärken ). In R. Hinz & Schumacher, B. (Hrsg.), Auf den Anfang kommt es an: Kompetenzen entwickeln – Kompetenzen stärken (S. S. 67-76). Wiesbaden: VS Verlag für Sozialwissenschaften.
 (150.25 KB)
Peschel, M. . (2005). Lernchance Computer? (Tagungsband der Hans-Böckler-Stiftung). Tagungsband der Hans-Böckler-Stiftung.
Peschel, M. , Fröhler, N. , Hürtgen, S. , Schlüter, C. & Thiedke, M. . (2004). „Demokratie beginnt in der Schule .. auch nach PISA .. !?“. Ergebnisse von PISA 2000 (Wir können auch anders. Perspektiven von Demokratie und Partizipation). In Wir können auch anders. Perspektiven von Demokratie und Partizipation (Schriftenreihe Hans-Böckler-Stiftung.). Münster: Dampfboot Verlag.
Peschel, M. . (2003). Der Computer im Anfangsunterricht Deutsch – Schreibmaschine oder multimediale Lernhilfe .. (Tagungsbeitrag der DGfE-Grundschultagung in Bremen). Tagungsbeitrag der DGfE-Grundschultagung in Bremen, 34-38.
Peschel, M. . (2003). Die "Dichterlesung". Ein Element der schriftlichen Kommunikation beim Schriftspracherwerb mit "Lesen durch Schreiben" (Grundschulpädagogik meets Kindheitsforschung. Zum Wechselverständnis von schulischem Lernen und außerschulischen Erfahrungen im Grundschulalter). In A. Panagiotopoulou & Brügelmann, H. (Hrsg.), Grundschulpädagogik meets Kindheitsforschung. Zum Wechselverständnis von schulischem Lernen und außerschulischen Erfahrungen im Grundschulalter (Jahrbuch Grundschulforschung., S. 145-149). Opladen: Leske + Budrich Verlag.
Peschel, M. . (2002). Du schreibst, Ich lese! – Lesen und Schreiben lernen mit Text-To-Speech-Software (Alphabetisierung und Sprachenlernen). In T. Fitzner (Hrsg.), Alphabetisierung und Sprachenlernen. Stuttgart: Klett Verlag.
Peschel, M. . (2002). Schriftmaschine Computer. Eine multimediale Lerneinheit im Anfangsunterricht Deutsch (Grundschule). In Grundschule. Braunschweig: Westermann Verlag.

Projekte im Fokus

Das Dachprojekt Digitale Grundschule ( bündelt und organisiert die...

Projekte im Fokus

Übergeordnetes Ziel des Projektes QUANTAG („Quanten im Alltag") ist es, einer möglichst breiten...
Go to top