Publikationen (Lehrstuhl)

Ergebnisse exportiert:
2022
Haider, M., Peschel, M., Irion, T., Gryl, I., Schmeinck, D., & Brämer, M.. (2022). Die Veränderung der Lebenswelt der Kinder und ihre Folgen für Sachunterricht, Lehrkräftebildung und sachunterrichtsdidaktische Forschung. In A. Becher, Blumberg, E., Goll, T., Michalik, K., & Tenberge, C. (Hrsg.), Sachunterricht in der Informationsgesellschaft (Bd. 32, Probleme und Perspektiven des Sachunterrichts, S. 55-72). Bad Heilbrunn: Verlag Julius Klinkhardt.
PDF icon Haider et al. (2022) - Die Veränderung der Lebenswelt.pdf (1.04 MB)
Fischer, M., & Peschel, M.. (2022). Fachliche Konzepte zum Thema „Schwimmen und Sinken“ im Sachunterricht. In " GDSU" (Hrsg.), GDSU-Journal, März 2022 (Bd. 13, S. 53-56). Berlin: GDSU e. V.
PDF icon Fischer & Peschel (2022) - Fachliche Konzepte zum Thema Schwimmen und Sinken.pdf (956.12 KB)
Peschel, M., Seibert, J., & Lauer, L.. (2022). Fach-Mediales Lernen – Augmented Reality (AR) im Chemie- und Sachunterricht. In S. Habig (Hrsg.), Unsicherheit als Element von naturwissenschaftsbezogenen Bildungsprozessen. Gesellschaft für Didaktik der Chemie und Physik, Online-Jahrestagung 2021. Duisburg: Universität Duisburg-Essen. Abgerufen von https://www.gdcp-ev.de/wp-content/tb2022/TB2022_416_Peschel.pdf
PDF icon Peschel et al. (2022) – Fach-Mediales Lernen.pdf (400.45 KB)
Kihm, P., & Peschel, M.. (2022). Gute Aufgaben 2.0 – Aufgaben und Aufgabenkulturen im Rahmen der Digitalisierung. In A. Becher, Blumberg, E., Goll, T., Michalik, K., & Tenberge, C. (Hrsg.), Sachunterricht in der Informationsgesellschaft (Bd. 32, Probleme und Perspektiven des Sachunterrichts, S. 89-95). Bad Heilbrunn: Verlag Julius Klinkhardt.
PDF icon Kihm & Peschel (2022) - Gute Aufgaben 2.0.pdf (855.79 KB)
Lauer, L., & Peschel, M.. (2022). Inwiefern eignen sich Augmented Reality-Technologien für den Einsatz im Sachunterricht der Primarstufe?. In " GDSU" (Hrsg.), GDSU-Journal, März 2022 (Bd. 13, S. 94-96). Berlin: GDSU e. V.
PDF icon Lauer & Peschel (2022) - Inwiefern eignen sich AR-Technologien.pdf (853.29 KB)
Kelkel, M., & Peschel, M.. (2022). Offline- vs. Online-Formate – Eine Gegenüberstellung verschiedener Formate GOFEX-Präsentationen. In " GDSU" (Hrsg.), GDSU-Journal, März 2022 (Bd. 13, S. 102-104). Berlin: GDSU e. V.
PDF icon Kelkel & Peschel (2022) - Offline- vs. Online-Formate.pdf (788.89 KB)
2021
Kihm, P., & Peschel, M.. (2021). Aufgaben und Kulturen des Lernens. „Gute Aufgaben“ als (Ver-)Mittler einer Lehr-Lern-Kultur. In M. Peschel (Hrsg.), Didaktik der Lernkulturen (Bd. 153, Beiträge zur Reform der Grundschule, S. 79-103). Frankfurt a. M.: Grundschulverband e. V.
Kihm, P., & Peschel, M.. (2021). Aushandlung von Selbstbestimmung in Experimentier-Lehr-Lern-Situationen im Grundschullabor für Offenes Experimentieren (doing AGENCY). In Zentrum für Lehrerbildung (ZfL) Universität des Saarlandes. Newsletter (Bd. 2, S. 6-9). Saarbrücken: Universität des Saarlandes.
PDF icon Kihm & Peschel (2021) - Aushandlung von Selbstbestimmung.pdf (1.01 MB)
Peschel, M. (2021). Das Fahrrad im Sachunterricht. Ein fachübergreifendes Thema für die Grundschule. In Radfahren (Bd. 29, Grundschule Sport, S. 23-25). Seelze: Friedrich Verlag. Abgerufen von https://www.friedrich-verlag.de/shop/radfahren-1420029
PDF icon Kihm & Peschel (2021) - Das habt ihr jetzt ja oft genug gemacht.pdf (158.29 KB)
Lang, V., Seibert, J., Eichinger, A., Bach, S., Kelkel, M., Peschel, M., u. a.. (2021). Das Projekt SCIENCE without FICTION innerhalb des Reality-Virtuality-Continuum. In S. Habig (Hrsg.), Naturwissenschaftlicher Unterricht und Lehrerbildung im Umbruch? Gesellschaft für Didaktik der Chemie und Physik. Jahrestagung in Aachen 2020 (Bd. 41, Gesellschaft für Didaktik der Chemie und Physik (GDCP), S. 374-377). Regensburg: Gesellschaft für Didaktik der Chemie und Physik (GDCP). Abgerufen von https://www.gdcp-ev.de/wp-content/tb2021/TB2021_374_Lang.pdf
PDF icon Lang et al. (2021) - Das Projekt SCIENCE without FICTION.pdf (984.32 KB)
PDF icon Neuböck-Hubinger, Peschel & Andersen (2021) – Das Unterrichtsthema Dinge im Wasser.pdf (107.89 KB)
Peschel, M. (2021). Demokratie und Digitalisierung im Sachunterricht. In T. Simon (Hrsg.), Demokratie im Sachunterricht – Sachunterricht in der Demokratie. Beiträge zum Verhältnis von Demokratie(lernen) und Sachunterricht(sdidaktik) (S. 131-145). Wiesbaden: Springer VS. doi:10.1007/978-3-658-33555-7_10
PDF icon Peschel (2021) - Demokratie und Digitalisierung im Sachunterricht.pdf (178.8 KB)
Kihm, P., & Peschel, M.. (2021). Demokratielernen durch Experimentieren?! – Aushandlung eines selbstbestimmten Vorgehens beim Offenen Experimentieren im Sachunterricht. In T. Simon (Hrsg.), Demokratie im Sachunterricht – Sachunterricht in der Demokratie. Beiträge zum Verhältnis von Demokratie(lernen) und Sachunterricht(sdidaktik) (S. 197-207). Wiesbaden: Springer VS. doi:10.1007/978-3-658-33555-7_15
PDF icon Kihm & Peschel (2021) - Demokratielernen durch Experimentieren.pdf (161.39 KB)
Peschel, M. (2021). Didaktik der Lernkulturen. Frankfurt a. M.: Grundschulverband e. V.
Lauer, L., & Peschel, M.. (2021). Gestaltung von Lehr-Lernumgebungen mit Augmented Reality (AR). In C. Maurer, Rincke, K., & Hemmer, M. (Hrsg.), Fachliche Bildung und digitale Transformation – Fachdidaktische Forschung und Diskurse. Fachtagung der Gesellschaft für Fachdidaktik 2020 (S. 64-67). Regensburg: Gesellschaft für Fachdidaktik (GFD). Abgerufen von https://www.pedocs.de/frontdoor.php?source_opus=21659
PDF icon Lauer & Peschel (2021) - Gestaltung von Lehr-Lernumgebungen.pdf (1.17 MB)
Peschel, M., Wedekind, H., Kihm, P., & Kelkel, M.. (2021). Hochschullernwerkstätten und Lernwerkstätten – Verortung in didaktischen Diskursen. In B. Holub, Himpsl-Gutermann, K., Mittlböck, K., Musilek-Hofer, M., Varelija-Gerber, A., & Grünberger, N. (Hrsg.), lern.medien.werk.statt. Hochschullernwerkstätten in der Digitalität (Bd. 9, Lernen und Studieren in Lernwerkstätten, S. 40-53). Bad Heilbrunn: Verlag Julius Klinkhardt. Abgerufen von https://klinkhardt.de/verlagsprogramm/2468.html
PDF icon Peschel et al. (2021) - Hochschullernwerkstätten und Lernwerkstätten.pdf (1.5 MB)
PDF icon Lauer et al. (2021) - Investigating the Usability.pdf (2.91 MB)
Kay, C. W., Peschel, M., Perels, F., Lauer, L., Seibert, J., Lang, V., u. a.. (2021). Kompetenzentwicklung durch didaktisch eingebettete Augmented Reality. In S. Habig (Hrsg.), Naturwissenschaftlicher Unterricht und Lehrerbildung im Umbruch? Gesellschaft für Didaktik der Chemie und Physik. Jahrestagung in Aachen 2020 (Bd. 41, Gesellschaft für Didaktik der Chemie und Physik (GDCP), S. 370-373). Regensburg: Gesellschaft für Didaktik der Chemie und Physik (GDCP). Abgerufen von https://www.gdcp-ev.de/wp-content/tb2021/TB2021_370_Kay.pdf
PDF icon Kay et al. (2021) - Kompetenzentwicklung durch didaktisch eingebettete AR.pdf (890.96 KB)
Kay, C. W., Peschel, M., Perels, F., Bach, S., Kelkel, M., Lauer, L., u. a.. (2021). Kompetenzentwicklung für die Naturwissenschaften durch Augmented Reality. In S. Habig (Hrsg.), Naturwissenschaftlicher Unterricht und Lehrerbildung im Umbruch? Gesellschaft für Didaktik der Chemie und Physik. Jahrestagung in Aachen 2020 (Bd. 41, Gesellschaft für Didaktik der Chemie und Physik (GDCP), S. 362-365). Regensburg: Gesellschaft für Didaktik der Chemie und Physik (GDCP). Abgerufen von https://www.gdcp-ev.de/wp-content/tb2021/TB2021_362_Kay.pdf
PDF icon Kay et al. (2021) - Kompetenzentwicklung für die Naturwissenschaften.pdf (925.76 KB)
Kihm, P., & Peschel, M.. (2021). „Komplexität wagen!“ – Methoden zur Beforschung von offenen Lehr-Lern-Prozessen in Hochschullernwerkstätten. In B. Holub, Himpsl-Gutermann, K., Mittlböck, K., Musilek-Hofer, M., Varelija-Gerber, A., & Grünberger, N. (Hrsg.), lern.medien.werk.statt. Hochschullernwerkstätten in der Digitalität (Bd. 9, Lernen und Studieren in Lernwerkstätten, S. 70-87). Bad Heilbrunn: Verlag Julius Klinkhardt. Abgerufen von https://klinkhardt.de/verlagsprogramm/2468.html
PDF icon Kihm & Peschel (2021) - Komplexität wagen.pdf (137.37 KB)
Peschel, M. (2021). Lernkulturen und Didaktik. Etablierung einer Lern-orientierten Didaktik über den Lern- und Kulturbegriff. In M. Peschel (Hrsg.), Didaktik der Lernkulturen (Bd. 153, Beiträge zur Reform der Grundschule, S. 7-29). Frankfurt a. M.: Grundschulverband e. V.
Wedekind, H., Kihm, P., & Peschel, M.. (2021). Lernwerkstattarbeit und Lernkulturen. Herausforderungen und Chancen einer Veränderung der Lernkultur durch Hochschullernwerkstätten. In M. Peschel (Hrsg.), Didaktik der Lernkulturen (Bd. 153, Beiträge zur Reform der Grundschule, S. 104-121). Frankfurt a. M.: Grundschulverband e. V.
Peschel, M. (2021). Medieneinsatz und Medienentwicklung im Sachunterricht am Beispiel von (digitalen) Karten. In N. Böhme, Dreer, B., Hahn, H., Heinecke, S., Mannhaupt, G., & Tänzer, S. (Hrsg.), Mythen, Widersprüche und Gewissheiten der Grundschulforschung. Eine wissenschaftliche Bestandsaufnahme nach 100 Jahren Grundschule (S. 187-193). Wiesbaden: Springer VS. doi:10.1007/978-3-658-31737-9_22
PDF icon Peschel (2021) - Medieneinsatz und Medienentwicklung.pdf (281.21 KB)
Weber, A., Peschel, M., Kihm, P., Fischer, M., & Dahm, T.. (2021). Phänomene am Schulanfang. „Mit offenen Augen durch die Welt und in die Schule gehen“. In Schulstart – was Kinder jetzt brauchen (Bd. 155, Grundschule aktuell, S. 22-23). Frankfurt a. M.: Grundschulverband e. V.
PDF icon Weber et al. (2021) - Phänomene am Schulanfang.pdf (716.07 KB)
Kelkel, M., Peschel, M., & Kihm, P.. (2021). Potenziale der pädagogisch-didaktischen Öffnung in Hochschullernwerkstätten. In B. Holub, Himpsl-Gutermann, K., Mittlböck, K., Musilek-Hofer, M., Varelija-Gerber, A., & Grünberger, N. (Hrsg.), lern.medien.werk.statt. Hochschullernwerkstätten in der Digitalität (Bd. 9, Lernen und Studieren in Lernwerkstätten, S. 321-334). Bad Heilbrunn: Verlag Julius Klinkhardt. Abgerufen von https://klinkhardt.de/verlagsprogramm/2468.html
PDF icon Kelkel et al. (2021) - Potenziale der pädagogisch-didaktischen Öffnung.pdf (1.6 MB)
Eichinger, A., Schmoll, I., Kelkel, M., Seibert, J., Lauer, L., Lang, V., u. a.. (2021). QUANTAG: Augmented-Reality-Campus-Rallye als Einstieg in die Quantentechnologie. In S. Habig (Hrsg.), Naturwissenschaftlicher Unterricht und Lehrerbildung im Umbruch? Gesellschaft für Didaktik der Chemie und Physik. Jahrestagung in Aachen 2020 (Bd. 41, Gesellschaft für Didaktik der Chemie und Physik (GDCP), S. 366-369). Regensburg: Gesellschaft für Didaktik der Chemie und Physik (GDCP). Abgerufen von https://www.gdcp-ev.de/wp-content/tb2021/TB2021_366_Eichinger.pdf
PDF icon Eichinger et al. (2021) - QUANTAG.pdf (951.97 KB)
Lauer, L., Peschel, M., Seibert, J., Lang, V., Eichinger, A., Altmeyer, K., u. a.. (2021). Untersuchung der Wirkungen von AR-Visualisierungstechniken in der Primarstufe. In S. Habig (Hrsg.), Naturwissenschaftlicher Unterricht und Lehrerbildung im Umbruch? Gesellschaft für Didaktik der Chemie und Physik. Jahrestagung in Aachen 2020 (Bd. 41, Gesellschaft für Didaktik der Chemie und Physik (GDCP), S. 378-381). Regensburg: Gesellschaft für Didaktik der Chemie und Physik (GDCP). Abgerufen von https://www.gdcp-ev.de/wp-content/tb2021/TB2021_378_Lauer.pdf
PDF icon Lauer et al. (2021) - Untersuchung der Wirkungen.pdf (943.53 KB)
2020
Seibert, J., Marquardt, M., Lang, V., Lauer, L., Peschel, M., Perels, F., u. a.. (2020). AR-MEI-SE: Augmented Reality Multitouch Experiment Instruction in Science Education. In S. Habig (Hrsg.), Naturwissenschaftliche Kompetenzen in der Gesellschaft von morgen. Gesellschaft für Didaktik der Chemie und Physik, Jahrestagung in Wien 2019 (S. 952-955). Duisburg: Universität Duisburg-Essen. Abgerufen von https://www.gdcp-ev.de/wp-content/tb2020/TB2020_952_Seibert.pdf
PDF icon SeibertMarquardtLangLauerPeschelPerelsHuwerKay (2020).AR-MEI-SE: Augmented Reality Multitouch Experiment Instruction in Science  (157.85 KB)
Marquardt, M., Seibert, J., Lauer, L., Lang, V., Peschel, M., & Kay, C. W.. (2020). Augmented Reality als Werkzeug zur Verknüpfung des Periodensystems der Elemente mit dem Bohr’schen Atommodell. In S. Habig (Hrsg.), Naturwissenschaftliche Kompetenzen in der Gesellschaft von morgen. Gesellschaft für Didaktik der Chemie und Physik, Jahrestagung in Wien 2019 (S. 948-951). Duisburg: Universität Duisburg-Essen. Abgerufen von https://www.gdcp-ev.de/wp-content/tb2020/TB2020_948_Marquardt.pdf
PDF icon Marquardt, Seibert, Lauer, Lang, Peschel, Kay (2020). AR als Werkzeuge zur Verknüpfung des PSE mit dem Bohrschen Atommodell.pdf (311.6 KB)
Peschel, M., Kay, C. W., Lauer, L., Seibert, J., Marquardt, M., & Lang, V.. (2020). Augmented Reality (AR) als Werkzeug im naturwissenschaftlichen Unterricht. In S. Habig (Hrsg.), Naturwissenschaftliche Kompetenzen in der Gesellschaft von morgen. Gesellschaft für Didaktik der Chemie und Physik, Jahrestagung in Wien 2019 (S. 940-943). Duisburg: Universität Duisburg-Essen. Abgerufen von https://www.gdcp-ev.de/wp-content/tb2020/TB2020_940_Peschel.pdf
PDF icon Peschel, Kay, Lauer, Seibert, Marquardt, Lang (2020).AR als Werkzeug im nw Unterricht.pdf (191.75 KB)
Lauer, L., Peschel, M., Marquardt, M., Seibert, J., Lang, V., & Kay, C. W.. (2020). Augmented Reality (AR) in der Primarstufe – Entwicklung einer AR-gestützten Lehr-Lerneinheit zum Thema Elektrik. In S. Habig (Hrsg.), Naturwissenschaftliche Kompetenzen in der Gesellschaft von morgen. Gesellschaft für Didaktik der Chemie und Physik, Jahrestagung in Wien 2019 (S. 944-947). Duisburg: Universität Duisburg-Essen. Abgerufen von https://www.gdcp-ev.de/wp-content/tb2020/TB2020_944_Lauer.pdf
PDF icon Lauer, Peschel, Marquardt, Seibert, Lang, Kay (2020). AR in der Primarstufe Entwicklung einer AR-gestützten Lehr-Lerneinheit zum Thema Elektrik.pdf (201.25 KB)
Lang, V., Seibert, J., Marquardt, M., Lauer, L., Peschel, M., Perels, F., u. a.. (2020). Augmented Reality Lab License 2.0. In S. Habig (Hrsg.), Naturwissenschaftliche Kompetenzen in der Gesellschaft von morgen. Gesellschaft für Didaktik der Chemie und Physik, Jahrestagung in Wien 2019 (S. 956-959). Duisburg: Universität Duisburg-Essen. Abgerufen von https://www.gdcp-ev.de/wp-content/tb2020/TB2020_956_Lang.pdf
PDF icon Lang, Seibert, Marquardt, Lauer, Peschel, Perels, Kay, Huwer (2020). AR Lab License 2.0.pdf (177.5 KB)
Seibert, J., Lauer, L., Marquardt, M., Peschel, M., & Kay, C. W.. (2020). deAR: didaktisch eingebettete Augmented Reality. In K. Kaspar, Becker-Mrotzek, M., Hofhues, S., König, J., & Schmeinck, D. (Hrsg.), Bildung, Schule, Digitalisierung (S. 451-456). Münster: Waxmann Verlag.
PDF icon Seibert et al. (2020) - deAR, didaktisch eingebettete Augmented Reality.pdf (1.18 MB)
Kihm, P., Rech, E., Schmidt, R. - J., Senzig, H., & Peschel, M.. (2020). „Digitalisierung und Schulschließungen“ in der SARS-CoV-2-Pandemie Berichtsanalyse im Zeitraum Januar bis Juli 2020. In Grundschule in und nach Corona (Bd. 152, Grundschule aktuell, S. 29-32). Frankfurt a. M.: Grundschulverband e. V.
Bach, S. (2020). Eine Exkursion ins Museum und ihre mediale Aufbereitung mit kidipedia. Ein Beispiel zur Förderung fachlicher und medialer Kompetenzen. In U. Hecker, Lassek, M., & Ramseger, J. (Hrsg.), Kinder lernen Zukunft. Anforderungen und tragfähige Grundlagen (Bd. 150, Beiträge zur Reform der Grundschule, S. 181-190). Frankfurt a. M.: Grundschulverband e. V.
Kihm, P., & Peschel, M.. (2020). Einflüsse von Aushandlungs- und Interaktionsprozessen auf Lernwerkstattarbeit. In U. Stadler-Altmann, Schumacher, S., Emili, E. Angelo, & Torre, E. Dalla (Hrsg.), Spielen, Lernen, Arbeiten in Lernwerkstätten. Facetten der Kooperation und Kollaboration (Bd. 7, Lernen und Studieren in Lernwerkstätten, S. 87-99). Bad Heilbrunn: Verlag Julius Klinkhardt.
PDF icon Kihm & Peschel (2020) - Einflüsse von Aushandlung.pdf (208.06 KB)
Peschel, M. (2020). Grundschulen müssen zu Schulen für JEDES Kind werden, erst dann sind sie eine Schule für ALLE Kinder!. In Forum Zukunft Grundschule (2). Medienbildung – Religion(en) – Inklusive Schule (Bd. 149, Grundschule aktuell, S. 2). Frankfurt a. M.: Grundschulverband e. V.
Peschel, M., & Kihm, P.. (2020). Hochschullernwerkstätten – Rollen, Rollenverständnisse und Rollenaushandlungen. In K. Kramer, Rumpf, D., Schöps, M., & Winter, S. (Hrsg.), Hochschullernwerkstätten – Elemente von Hochschulentwicklung? Ein Rückblick auf 15 Jahre Hochschullernwerkstatt in Halle und andernorts (Bd. 8, Lernen und Studieren in Lernwerkstätten, S. 296-310). Bad Heilbrunn: Verlag Julius Klinkhardt.
PDF icon Peschel & Kihm (2020) - Hochschullernwerkstätten – Rollen.pdf (119.27 KB)
Bach, S. (2020). Homeschooling – Mit kidipedia trotz Corona für die Schule lernen. Blogbeitrag im Blog der Heidelberg School of Education (HSE). Abgerufen von https://hse.hypotheses.org/2512
Kihm, P., & Peschel, M.. (2020). Lehr-Lern-Handeln an außerschulischen Lernorten (AL) – am Beispiel des Grundschullabors für Offenes Experimentieren (GOFEX). In L. Beyer, Gorr, C., Kather, C., Komorek, M., Röben, P., & Selle, S. (Hrsg.), Orte und Prozesse außerschulischen Lernens erforschen und weiterentwickeln. Tagungsband zur 6. Tagung Außerschulische Lernorte an der Carl von Ossietzky Universität Oldenburg vom 29.-31. August 2018 (Bd. 6, Außerschulische Lernorte – Beiträge zur Didaktik, S. 111-119). Münster: LIT Verlag.
Kunkel, C., & Peschel, M.. (2020). Lernen mit und über digitale Medien im Sachunterricht. Entwicklung eines vielperspektivischen Konzepts zur Erschliessung digitaler Medien. In MedienPädagogik. Zeitschrift für Theorie und Praxis der Medienbildung (Bd. 17, Jahrbuch Medienpädagogik, S. 455-476).
PDF icon Kunkel, Peschel (2020) Lernen mit und über digitale Medien (1.11 MB)
Peschel, M. (2020). Lernwerkstätten und Hochschullernwerkstätten. Begrifflichkeiten und Entwicklungen. In Journal für LehrerInnenbildung (jlb) (Bd. 3, S. 96-105). Bad Heilbrunn: Verlag Julius Klinkhardt. Abgerufen von https://jlb-journallehrerinnenbildung.net/heft-3-2020-lehrerinnenbildung-fuer-die-primarstufe/
PDF icon Peschel (2020) - Lernwerkstätten und Hochschullernwerkstätten. Begrifflichkeiten und Entwicklungen.pdf (394.84 KB)
Peschel, M. (2020). Lernwerkstätten und Hochschullernwerkstätten. Lernwerkstätten und ihre Didaktik in der Hochschullehre.. In Zusammenarbeit an der Schule (Bd. Band 151, Grundschule aktuell, S. 34-35). Frankfurt a. M.: Grundschulverband e. V.
Lauer, L., Peschel, M., Bach, S., & Seibert, J.. (2020). Modellierungen Medialen Lernens. In K. Kaspar, Becker-Mrotzek, M., Hofhues, S., König, J., & Schmeinck, D. (Hrsg.), Bildung, Schule, Digitalisierung (S. 382-387). Münster: Waxmann Verlag.
PDF icon Lauer et al. (2020) - Modellierungen Medialen Lernens.pdf (644.96 KB)
Kelkel, M., & Peschel, M.. (2020). Professionalisierung von Lehramtsstudierenden im GOFEX_Projektpraktikum durch Studierenden-Co-Reflexion. In U. Stadler-Altmann, Schumacher, S., Emili, E. Angelo, & Torre, E. Dalla (Hrsg.), Spielen, Lernen, Arbeiten in Lernwerkstätten. Facetten der Kooperation und Kollaboration. (Bd. 7, Lernen und Studieren in Lernwerkstätten, S. 64-77). Bad Heilbrunn: Verlag Julius Klinkhardt.
PDF icon Kelkel & Peschel (2020) - Professionalisierung von Lehramtsstudierenden.pdf (371.61 KB)
Kihm, P., Diener, J., & Peschel, M.. (2020). Qualifizierungsprozesse und Qualifikationsarbeiten in Hochschullernwerkstätten – Forschende Entwicklung einer innovativen Didaktik. In K. Kramer, Rumpf, D., Schöps, M., & Winter, S. (Hrsg.), Hochschullernwerkstätten – Elemente von Hochschulentwicklung? Ein Rückblick auf 15 Jahre Hochschullernwerkstatt in Halle und andernorts (Bd. 8, Lernen und Studieren in Lernwerkstätten, S. 321-335). Bad Heilbrunn: Verlag Julius Klinkhardt.
PDF icon Kihm, Diener & Peschel (2020) - Qualifizierungsprozesse und Qualifikationsarbeiten.pdf (123.07 KB)
PDF icon Peschel, Kihm, Fischer (2020) Sachunterricht und Bildung.pdf (475.94 KB)
Peschel, M. (2020). Sprache und Sache. Sprachunterricht ist auch Fachunterricht. In U. Hecker, Lassek, M., & Ramseger, J. (Hrsg.), Kinder lernen Zukunft. Über die Fächer hinaus – Prinzipien und Perspektiven (Bd. 151, Beiträge zur Reform der Grundschule, S. 125-136). Frankfurt a. M.: Grundschulverband e. V.
PDF icon WegweiserWiSe20_21.pdf (1.83 MB)
Peschel, M. (2020). Welterschließung als sachunterrichtliches Lernen mit und über digitale Medien. In M. Thumel, Kammerl, R., & Irion, T. (Hrsg.), Digitale Bildung im Grundschulalter. Grundsatzfragen zum Primat des Pädagogischen (S. 341-355). München: Kopaed Verlag.
2019
Peschel, M. (2019). Arme Kinder – arme Schule. Wie gerecht ist unser Bildungssystem?. In Forum Zukunft Grundschule (1). Bildung – Gerechtigkeit – Demokratie (Bd. 148, Grundschule aktuell, S. 26-29). Frankfurt a. M.: Grundschulverband e. V.
PDF icon Peschel2019ArmeKinderarmeSchule.pdf (313.45 KB)
Peschel, M. (2019). Digitalisierung und Demokratie. In Die Grundschulzeitschrift (Bd. 316, Lernen im Dialog, S. 48). Seelze: Friedrich Verlag.
Kihm, P., & Peschel, M.. (2019). doing AGENCY – der Transfer von AGENCY-Elementen in Lernwerkstätten am Beispiel des Grundschullabors für Offenes Experimentieren. In S. Tänzer, Godau, M., Berger, M., & Mannhaupt, G. (Hrsg.), Perspektiven auf Hochschullernwerkstätten. Wechselspiele zwischen Individuum, Gemeinschaft, Ding und Raum (Bd. 6, Lernen und Studieren in Lernwerkstätten, S. 184-188). Bad Heilbrunn: Verlag Julius Klinkhardt.
Bach, S., & Peschel, M.. (2019). Erweiterung des Medienangebotes in kidipedia – Entwicklung, Implementierung, Erprobung und Evaluation eines Mapping-Tools in Form digitaler, interaktiver Karten. In M. Peschel & Carle, U. (Hrsg.), Praxisforschung Sachunterricht (Bd. 11, Dimensionen des Sachunterrichts – Kinder.Sachen.Welten, S. 137-152). Baltmannsweiler: Schneider Verlag Hohengehren.
Peschel, M., & Kihm, P.. (2019). Fachliche Kompetenz der Lernbegleitung in Lernwerkstätten. In R. Baar, Feindt, A., & Trostmann, S. (Hrsg.), Struktur und Handlung in Lernwerkstätten. Hochschuldidaktische Räume zwischen Einschränkung und Ermöglichung (Bd. 5, Lernen und Studieren in Lernwerkstätten, S. 84-95). Bad Heilbrunn: Verlag Julius Klinkhardt.
Kelkel, M., & Markus, P.. (2019). Förderung der beruflichen Handlungsfähigkeit von Studierenden im Sachunterricht durch das GOFEX_Projektpraktikum. In S. Tänzer, Godau, M., Berger, M., & Mannhaupt, G. (Hrsg.), Perspektiven auf Hochschullernwerkstätten. Wechselspiele zwischen Individuum, Gemeinschaft, Ding und Raum (Bd. 6, Lernen und Studieren in Lernwerkstätten, S. 157-167). Bad Heilbrunn: Verlag Julius Klinkhardt.
Kihm, P., Peschel, M., & Diener, J.. (2019). Kinderfragen in der Lernwerkstatt. In R. Baar, Feindt, A., & Trostmann, S. (Hrsg.), Struktur und Handlung in Lernwerkstätten. Hochschuldidaktische Räume zwischen Einschränkung und Ermöglichung (Bd. 5, Lernen und Studieren in Lernwerkstätten, S. 109-120). Bad Heilbrunn: Verlag Julius Klinkhardt.
Peschel, M., & Diener, J.. (2019). Lehrerhandeln im Grundschullabor für Offenes Experimentieren. In M. Peschel & Carle, U. (Hrsg.), Praxisforschung Sachunterricht (Bd. 11, Dimensionen des Sachunterrichts – Kinder.Sachen.Welten, S. 11-34). Baltmannsweiler: Schneider Verlag Hohengehren.
Kelkel, M., & Peschel, M.. (2019). Lernwerkstätten und Schülerlabore – Unterschiedliche Konzepte, ein Verbund. Kooperation zwischen GOFEX und NanoBioLab im Rahmen des GOFEX-Projektpraktikums als Beispiel für kooperatives Lernen. In R. Baar, Feindt, A., & Trostmann, S. (Hrsg.), Struktur und Handlung in Lernwerkstätten. Hochschuldidaktische Räume zwischen Einschränkung und Ermöglichung (Bd. 5, Lernen und Studieren in Lernwerkstätten, S. 185-189). Bad Heilbrunn: Verlag Julius Klinkhardt.
Peschel, M. (2019). Milliarden für die Bildung. Grundlegende Forderungen an den Digitalpakt.. In Die Grundschulzeitschrift (Bd. 318, Visualisieren, S. 43). Seelze: Friedrich Verlag.
Peschel, M., & Kihm, P.. (2019). Naturwissenschaftliche Phänomene im Grundschullabor für Offenes Experimentieren (GOFEX) entdecken. In Zeitschrift "Erziehung und Wissenschaft im Saarland" des Landesverbandes der GEW im DGB (02/2019. Aufl., Bd. 65. Jahrgang , S. 14-15).
PDF icon Peschel, Kihm (2018). Naturwissenschaftliche Phänomen im Grundschullabor für Offenes Experimentieren entdecken..pdf (846.91 KB)
Peschel, M., Carle, U., & Diener, J.. (2019). Praxisforschung Sachunterricht. In M. Peschel & Carle, U. (Hrsg.), Praxisforschung Sachunterricht (Bd. 11, Dimensionen des Sachunterrichts – Kinder.Sachen.Welten, S. 5-10). Baltmannsweiler: Schneider Verlag Hohengehren.
Peschel, M., & Carle, U.. (2019). Praxisforschung Sachunterricht. Baltmannsweiler: Schneider Verlag Hohengehren.
2018
Peschel, M. (2018). Digitales Lernen vs. analoges Lernen – Digitale Bildung in einer analogen Welt oder: Bildung für eine Welt mit digitalen Medien. In Wozu brauchen wir digitale Medien? (Bd. 142, Grundschule aktuell, S. 12-15). Frankfurt a. M.: Grundschulverband e. V.
Kelkel, M., & Peschel, M.. (2018). Fachlichkeit in Lernwerkstätten. In M. Peschel & Kelkel, M. (Hrsg.), Fachlichkeit in Lernwerkstätten – Kind und Sache in Lernwerkstätten (Bd. 4, Lernen und Studieren in Lernwerkstätten, S. 15-34). Bad Heilbrunn: Verlag Julius Klinkhardt.
Peschel, M., & Kelkel, M.. (2018). Fachlichkeit in Lernwerkstätten. Kind und Sache in Lernwerkstätten. Bad Heilbrunn: Verlag Julius Klinkhardt. doi:doi.org/10.35468/5652
PDF icon Peschel & Kelkel (2018) - Fachlichkeit in Lernwerkstätten.pdf (7.87 MB)
Schirra, S., Peschel, M., & Scherer, N.. (2018). „kidi on tour“ – Mobile Learning und das Potenzial digitaler Geomedien zur Vermittlung digitaler Raum-Zeitlichkeit am Beispiel von GOFEX und kidipedia. In M. Pietraß, Fromme, J., Grell, P., & Hug, T. (Hrsg.), Jahrbuch Medienpädagogik 14. Der digitale Raum – Medienpädagogische Untersuchungen und Perspektiven (S. 157-175). Wiesbaden: Springer VS.
PDF icon Peschel, M., Schirra, S., Scherer, N. (2018). kidi on tour-Mobile Learning und das Potenzial digitaler Geomedien (...) (843.24 KB)
Schirra, S., & Peschel, M.. (2018). kidipedia. Digitale Medien pädagogisch sinnvoll im Unterricht einsetzen.. In EuWiS. Zeitung ‚Erziehung und Wissenschaft im Saarland’ des Landesverbandes der GEW im DGB (S. 13-14). Abgerufen von http://www.gew.saarland/images/pdf/EuWiS_05-2018.pdf
PDF icon kidipedia. Digitale Medien pädagogisch sinnvoll im Unterricht einsetzen. (8.91 MB)
Kihm, P., Diener, J., & Peschel, M.. (2018). Kinder forschen – Wege zur (gemeinsamen) Erkenntnis. In M. Peschel & Kelkel, M. (Hrsg.), Fachlichkeit in Lernwerkstätten. Kind und Sache in Lernwerkstätten. (Bd. 4, Lernen und Studieren in Lernwerkstätten, S. 66-84). Bad Heilbrunn: Verlag Julius Klinkhardt.
PDF icon kleines3x3zuSmartKids.pdf (2.54 MB)
Huwer, J., Lauer, L., Seibert, J., Thyssen, C., Dörrenbächer-Ulrich, L., & Perels, F.. (2018). Re-Experiencing Chemistry with Augmented Reality: New Possibilities for Individual Support. In World Journal of Chemical Education (5. Aufl., Bd. 6, S. 212-217). doi:10.12691/wjce-6-5-2
ValiZadeh, M., & Peschel, M.. (2018). SelfPro – Entwicklung von Selbstkonzepten beim Offenen Experimentieren. In U. Franz, Giest, H., Hartinger, A., Heinrich-Dönges, A., & Reinhoffer, B. (Hrsg.), Handeln im Sachunterricht (Bd. 28, Probleme und Perspektiven des Sachunterrichts, S. 183-190). Bad Heilbrunn: Verlag Julius Klinkhardt.
PDF icon Dissertation_Sarah Bach-komprimiert.pdf (8.71 MB)
Peschel, M., & Kelkel, M.. (2018). Zur Sache!. In M. Peschel & Kelkel, M. (Hrsg.), Fachlichkeit in Lernwerkstätten – Kind und Sache in Lernwerkstätten (Bd. 4, Lernen und Studieren in Lernwerkstätten, S. 9-14). Bad Heilbrunn: Verlag Julius Klinkhardt.
2017
Peschel, M., Kihm, P., Scherer, N., & Kelkel, M.. (2017). Einstellungen zum Experimentieren im Lehramt Primarstufe. In LeLa Magazin (17. Aufl., Bd. März 2017, S. 12-13).
PDF icon Peschel, Kelkel, Kihm, Scherer (2017). Einstellungen zum Experimentieren im Lehramt Primarstufe..pdf (385.46 KB)
Carle, U., & Peschel, M.. (2017). Forschung für die Praxis – Plädoyer für schulpraktisch relevante Forschung. In M. Peschel & Carle, U. (Hrsg.), Forschung für die Praxis (Bd. 143, Beiträge zur Reform der Grundschule, S. 8-19). Frankfurt a. M.: Grundschulverband e. V.
Kihm, P., & Peschel, M.. (2017). Interaktion und Kommunikation beim Experimentieren von Kindern – Eine Untersuchung über interaktions- und kommunikationsförderliche Aufgabenformate. In M. Peschel & Carle, U. (Hrsg.), Forschung für die Praxis (Bd. 143, Beiträge zur Reform der Grundschule, S. 68-80). Frankfurt a. M.: Grundschulverband e. V.
Schirra, S., & Peschel, M.. (2017). Kinder kindgerecht an digitale Medien heranführen. In KiTa aktuell. Fachzeitschrift für Leitungen, Fachkräfte und Träger der Kindertagesbetreuung (Bd. 25, S. 112-114).
Peschel, M., & Lang, M.. (2017). Selbstkonzeptentwicklung durch Offenes Experimentieren. In GDSU-Journal 7 (S. S.65-77). Berlin: GDSU e. V.
PDF icon Peschel, Lang (2017). Selbstkonzeptentwicklung durch Offenes Experimentieren. (360.19 KB)
Peschel, M. (2017). SelfPro: Entwicklung von Professionsverständnissen und Selbstkonzepten angehender Lehrkräfte beim Offenen Experimentieren. In S. Miller, Holler-Nowitzki, B., Kottmann, B., Lesemann, S., Letmathe-Henkel, B., Meyer, N., u. a. (Hrsg.), Profession und Disziplin – Grundschulpädagogik im Diskurs (Bd. 22, Jahrbuch Grundschulforschung, S. 191-196). Wiesbaden: Springer VS.
PDF icon Peschel (2017). SelfPro.Entwicklung von Professionsverständnissen und Selbstkonzepten angehender Lehrkräfte beim Offen Experimentieren.pdf (282.7 KB)
Schirra, S., & Peschel, M.. (2017). Von Kids für Kids: Lernplattform kidipedia. Mediale und geografische Kompetenzen fördern. In Grundschulunterricht. Sachunterricht (Bd. 02/2017, S. 17-20).
2016
Weber, A. (2016). Ein Baum – Lebewesen und Lebensraum. In Lernkulturen. Wie Kinder lernen können (Bd. 136, Grundschule aktuell, S. 24-28). Frankfurt a. M.: Grundschulverband e. V. Abgerufen von http://grundschulverband.de/produkt/grundschule-aktuell-136-november-2016/
PDF icon Weber, A. (2016). Ein Baum - Lebewesen und Lebensraum.pdf (547.12 KB)
Peschel, M. (2016). Energie als Perspektivenvernetzender Themenbereich im Sachunterricht. In C. Maurer (Hrsg.), Authentizität und Lernen – das Fach in der Fachdidaktik (Bd. 36, Gesellschaft für Didaktik der Chemie und Physik, S. 373-375). Regensburg: Universität Regensburg.
PDF icon Peschel, M. (2016). Energie als Perspektivenvernetzender Themenbereich im Sachunterricht (597.17 KB)
Peschel, M. (2016). Entwicklung der selbst eingeschätzten Kompetenzen in der Sachunterrichtsausbildung im Saarland. In H. Giest, Goll, T., & Hartinger, A. (Hrsg.), Sachunterricht – zwischen Kompetenzorientierung, Persönlichkeitsentwicklung, Lebenswelt und Fachbezug (Bd. 26, Probleme und Perspektiven des Sachunterrichts, S. 149-157). Bad Heilbrunn: Verlag Julius Klinkhardt.
Diehl, A., & Peschel, M.. (2016). (Erneuerbare) Energie im Grundschullabor für Offenes Experimentieren. In C. Maurer (Hrsg.), Authentizität und Lernen – das Fach in der Fachdidaktik (Bd. 36, Gesellschaft für Didaktik der Chemie und Physik, S. 515-517). Regensburg: Universität Regensburg.
PDF icon Peschel, M. & Diehl, A. (2016). (Erneuerbare) Energie im Grundschullabor für Offenes Experimentieren (563 KB)
Kelkel, M., Peschel, M., & Urig, N.. (2016). GOFEX_EE – Erneuerbare Energien im praktischen Test. LeLa BNE Broschüre "Bildung für nachhaltige Entwicklung in Schülerlaboren", 62-65.
Irion, T., & Peschel, M.. (2016). Grundschule und neue Medien – Neue Entwicklungen. In M. Peschel & Irion, T. (Hrsg.), Neue Medien in der Grundschule 2.0 (Bd. 141, Beiträge zur Reform der Grundschule, S. 11-15). Frankfurt a. M.: Grundschulverband e. V.
Peschel, M. (2016). Inklusive Mediendidaktik in der Grundschule. In G. Erziehung Wissenschaft (Hrsg.), Erfolgreich mit Neuen Medien! – Was bringt das Lernen im Netz? (S. 33-36). Frankfurt a. M.: GEW.
PDF icon 2016_Peschel_Inklusive Mediendidaktik in der Grundschule.pdf (646.26 KB)
Peschel, M., Schirra, S., & Carell, S.. (2016). kidipedia – Ein Unterrichtsvorschlag. In M. Peschel (Hrsg.), Mediales Lernen – Beispiele für eine Inklusive Mediendidaktik (Bd. 7, Dimensionen des Sachunterrichts – Kinder.Sachen.Welten, S. 65-78). Baltmannsweiler: Schneider Verlag Hohengehren.
Peschel, M. (2016). Lernkulturen in der Grundschule und im Sachunterricht. In Lernkulturen. Wie Kinder lernen können (Bd. 136, Grundschule aktuell, S. S. 3-6). Frankfurt a. M.: Grundschulverband e. V. Abgerufen von https://www.yumpu.com/de/document/fullscreen/56231202/grundschule-aktuell-136
PDF icon Peschel (2016). Lernkulturen in der Grundschule und im Sachunterricht.pdf (414.61 KB)
Peschel, M. (Hrsg.). (2016). Mediales Lernen – Beispiele für eine inklusive Mediendidaktik. Baltmannsweiler: Schneider Verlag Hohengehren.
Peschel, M. (2016). Mediales Lernen – Eine Modellierung als Einleitung. In M. Peschel (Hrsg.), Mediales Lernen – Beispiele für eine Inklusive Mediendidaktik (Bd. 7, Dimensionen des Sachunterrichts – Kinder.Sachen.Welten, S. 7-16). Baltmannsweiler: Schneider Verlag Hohengehren.
Peschel, M. (2016). Medienlernen im Sachunterricht – Lernen mit Medien und Lernen über Medien. In M. Peschel & Irion, T. (Hrsg.), Neue Medien in der Grundschule 2.0 (Bd. 141, Beiträge zur Reform der Grundschule, S. 33-49). Frankfurt a. M.: Grundschulverband e. V.
Peschel, M. (2016). Neue Medien in der Grundschule 3.0. In M. Peschel & Irion, T. (Hrsg.), Neue Medien in der Grundschule 2.0 (Bd. 141, Beiträge zur Reform der Grundschule, S. 189-192). Frankfurt a. M.: Grundschulverband e. V.
Peschel, M. (2016). Offenes Experimentieren – Individuelles Lernen: Aufgaben in Lernwerkstätten. In H. Hahn, Esslinger-Hinz, I., & Panagiotopoulou, A. (Hrsg.), Paradigmen und Paradigmenwechsel in der Grundschulpädagogik (S. S. 120-131). Baltmannsweiler: Schneider Verlag Hohengehren.
PDF icon Peschel (2016) Offenes Experimentieren – individuelles Lernen.pdf (7.26 MB)
Schirra, S., & Peschel, M.. (2016). Recherchieren, Dokumentieren und Präsentieren mit kidipedia im Zeitalter von Tablets & Co. In M. Peschel & Irion, T. (Hrsg.), Neue Medien in der Grundschule 2.0 (Beiträge zur Reform der Grundschule., Bd. 141, S. 235-246). Frankfurt a. M.: Grundschulverband e. V.
Schirra, S., & Peschel, M.. (2016). Was geht? Neue Medien im Sachunterricht. In M. Peschel & Irion, T. (Hrsg.), Neue Medien in der Grundschule 2.0 (Bd. 141, Beiträge zur Reform der Grundschule, S. 309-315). Frankfurt a. M.: Grundschulverband e. V.
2015
Kihm, P., Knopf, J., & Ladel, S.. (2015). „Cu l8er – Cu2 :-)" – Was Kinder aus der SMS-Kommunikation lernen können. In Grundschulunterricht Mathematik (Bd. 1, S. 19-22). München: Oldenbourg Verlag.
Carell, S., & Peschel, M.. (2015). Einfluss des Onlinelexikons kidipedia auf die Naturwissenschaftskompetenz von Jungen und Mädchen an Schweizer Primschulen. In D. Blömer, Lichtblau, M., Jüttner, A. - K., Koch, K., Krüger, M., & Werning, R. (Hrsg.), Perspektiven auf inklusive Bildung – Gemeinsam anders lehren und lernen (Bd. 18, Jahrbuch Grundschulforschung, S. 216-223). Wiesbaden: Springer VS.
PDF icon Carell, Peschel (2015). Einfluss des Onlinelexikons kidipedia...pdf (662.42 KB)
Diehl, A., & Peschel, M.. (2015). GOFEX – Erneuerbare Energien. (L. Labor, Hrsg.)10 Jahre LeLa Jahrestagung – Festschrift, 43.
PDF icon Schirra, Warken, Peschel (2015). kidipedia-Einsatz eines (audio-)visuellen Bildungsmediums im geographisch-orientierten Sachunterricht.pdf (3.27 MB)
Carell, S., & Peschel, M.. (2015). Kompetenzentwicklung und Interessensveränderung im Sachunterricht bei Jungen und Mädchen aus Schweizer Primarschulen durch den Einsatz eines Onlinelexikons (kidipedia) für Kinder. In H. - J. Fischer, Giest, H., & Michalik, K. (Hrsg.), Bildung im und durch Sachunterricht (Bd. 25, Probleme und Perspektiven des Sachunterrichts, S. 101-106). Bad Heilbrunn: Verlag Julius Klinkhardt. Abgerufen von http://klinkhardt.de/verlagsprogramm/2020.html
Peschel, M., & Meiers, K.. (2015). Lesen im Sachunterricht. In Sache Wort Zahl. Lehren und Lernen in der Grundschule, Heft 150-151/43 (S. 60-69). Hallbergmoos: Aulis Verlag.
Peschel, M. (2015). Medien im Sachunterricht. Unterricht gestalten – Lernkulturen entwickeln. In Medienbildung (Bd. 131, Grundschule aktuell, S. 10-14). Frankfurt a. M.: Grundschulverband e. V.
Peschel, M. (2015). Medienerziehung im Sachunterricht. In J. Kahlert, Fölling-Albers, M., Götz, M., Miller, S., & Wittkowske, S. (Hrsg.), Handbuch Didaktik des Sachunterrichts (S. 173-179). Bad Heilbrunn: Verlag Julius Klinkhardt.
Peschel, M. (2015). Offenes Experimentieren – das Projekt SelfPro. In H. - J. Fischer, Giest, H., & Michalik, K. (Hrsg.), Bildung im und durch Sachunterricht (Bd. 25, Probleme und Perspektiven des Sachunterrichts, S. 59-64). Bad Heilbrunn: Verlag Julius Klinkhardt. Abgerufen von http://klinkhardt.de/verlagsprogramm/2020.html
Lang, M., & Peschel, M.. (2015). SINUS trifft GOFEX. (L. Labor, Hrsg.)10 Jahre LeLa Jahrestagung – Festschrift, 79.
2014
Peschel, M. (2014). Außerschulische Lernorte in der Sachunterrichtsausbildung. In D. Brovelli, Fuchs, K., Rempfler, A., & Häller, B. Sommer (Hrsg.), Ausserschulische Lernorte – Impulse aus der Praxis (S. 131-136). Münster: LIT Verlag.
Fischer, H. - J., Giest, H., & Peschel, M.. (2014). Editorial. In H. - J. Fischer, Giest, H., & Peschel, M. (Hrsg.), Lernsituationen und Aufgabenkultur im Sachunterricht (Bd. 24, Probleme und Perspektiven des Sachunterrichts, S. 9-16). Bad Heilbrunn: Verlag Julius Klinkhardt.
PDF icon Fischer, Giest & Peschel (2014) - Editorial.pdf (564.22 KB)
Giest, H., & Peschel, M.. (2014). Editorial. In H. Giest & Peschel, M. (Hrsg.), GDSU-Journal (Bd. 4, GDSU-Journal, S. 7-8). Berlin: GDSU e. V. Abgerufen von https://gdsu.de/sites/default/files/uploads/2014/10/Journal_4a.pdf
Giest, H., & Peschel, M.. (2014). GDSU-Journal Juli 2014, Heft 4. Berlin: GDSU e. V.
PDF icon Giest & Peschel (2014) - GDSU-Journal Juli 2014, Heft 4.pdf (697.33 KB)
Peschel, M. (2014). Individuelle Förderung beim naturwissenschaftlichen Lernen im Sachunterricht der Grundschule. In (Bd. 2, Zeitschrift für Grundschulforschung, S. 146-160). Bad Heilbrunn: Verlag Julius Klinkhardt.
Carell, S., & Peschel, M.. (2014). kidipedia – Ergebnisse eines Forschungsprojekts im Sachunterricht. In S. Bernholt (Hrsg.), Naturwissenschaftliche Bildung zwischen Science- und Fachunterricht. (Bd. 34, S. 489-491). Kiel: IPN.
PDF icon Peschel, Carell (2014). kidipedia - Ergebnisse eines Forschungsprojekts im Sachunterricht.pdf (1.34 MB)
Peschel, M., & Koch, A.. (2014). Lehrertypen – Typisch Lehrer?! Clusterungen im Projekt SUN. In S. Bernholt (Hrsg.), Naturwissenschaftliche Bildung zwischen Science- und Fachunterricht. (Bd. 34, S. 216-218). Kiel: IPN.
PDF icon Peschel, Koch (2014). Lehrertypen-Typisch Lehrer? Clusterungen im Projekt SUN (1.27 MB)
Peschel, M. (2014). Lernen mit und über Medien – Mediales Lernen im neuen Perspektivrahmen. In Grundschulmagazin (Bd. 2, S. 26-30). München: Oldenbourg Verlag.
PDF icon Open Access Zugang über PEDCOS (1.76 MB)
Hildebrandt, E., Peschel, M., & Weißhaupt, M.. (2014). Lernen zwischen freiem und instruiertem Tätigsein – eine Einführung. In E. Hildebrandt, Peschel, M., & Weißhaupt, M. (Hrsg.), Lernen zwischen freiem und instruiertem Tätigsein (1, Lernen und Studieren in Lernwerkstätten. Aufl., S. 9-13). Bad Heilbrunn: Verlag Julius Klinkhardt. doi:10.35468/5375_01
PDF icon Hildebrandt, Peschel & Weißhaupt (2014) - Lernen – eine Einführung.pdf (55.86 KB)
Peschel, M. (2014). Medienerziehung. In A. Hartinger & Lange, K. (Hrsg.), Sachunterricht – Didaktik für die Grundschule (S. 158-169). Berlin: Cornelsen Scriptor Verlag.
Carell, S., & Peschel, M.. (2014). Motivations- und Interessenveränderungen bei der Arbeit mit kidipedia.de.. In H. - J. Fischer, Giest, H., & Peschel, M. (Hrsg.), Lernsituationen und Aufgabenkultur im Sachunterricht (Bd. 24, Probleme und Perspektiven des Sachunterrichts, S. 79-86). Bad Heilbrunn: Verlag Julius Klinkhardt.
Peschel, M. (2014). Vom instruierten zum Freien Forschen – Selbstbestimmungskonzepte im GOFEX. In E. Hildebrandt, Peschel, M., & Weißhaupt, M. (Hrsg.), Lernen zwischen freiem und instruiertem Tätigsein (Bd. 1, Lernen und Studieren in Lernwerkstätten, S. 67-79). Bad Heilbrunn: Verlag Julius Klinkhardt.
PDF icon Peschel (2014) Selbstbestimmung im GOFEX.pdf (109.44 KB)
PDF icon Wegweiser WiSe 2014/15 (735.13 KB)
Kelkel, M., & Peschel, M.. (2014). Wer macht die Nacht? – Das Phänomen Nacht naturwissenschaftlich erkunden. In kindergarten heute (Bd. 06/2014, S. 32-34). Freiburg i. Br.: Verlag Herder.
2013
Peschel, M., Favre, P., & Mathis, C.. (2013). Einleitung. In M. Peschel, Favre, P., & Mathis, C. (Hrsg.), SaCHen unterriCHten – Beiträge zur Situation der Sachunterrichtsdidaktik in der deutschsprachigen Schweiz (Dimensionen des Sachunterrichts – Kinder.Sachen.Welten., S. 5-6). Baltmannsweiler: Schneider Verlag Hohengehren.
Peschel, M., & Carell, S.. (2013). Entwicklungen in der Medienpädagogik von Mosaik (1992/1993) zu kidipedia (2012) – zukunftsfähige Konzeption für den Sachunterricht?. In H. - J. Fischer, Giest, H., & Pech, D. (Hrsg.), Der Sachunterricht und seine Didaktik – Bestände prüfen und Perspektiven entwickeln (Bd. 23, Probleme und Perspektiven des Sachunterrichts, S. 121-128). Bad Heilbrunn: Verlag Julius Klinkhardt.
Schumacher, A., & Peschel, M.. (2013). Forschendes Lernen im Grundschullabor für Offenes Experimentieren (GOFEX). In S. Bernholt (Hrsg.), Inquiry-based learning – Forschendes Lernen. Gesellschaft für Didaktik der Chemie und Physik, Jahrestagung in Hannover 2012. (Bd. 33, S. 545-547). Kiel: IPN.
PDF icon Peschel, Schumacher (2013). Forschendes Lernen im Grundschullabor für Offenes Experimentieren .pdf (919.59 KB)
Carell, S., & Peschel, M.. (2013). Forschendes Lernen im Web 2.0 – kidipedia. In S. Bernholt (Hrsg.), Inquiry-based learning – Forschendes Lernen. Gesellschaft für Didaktik der Chemie und Physik (Bd. 33, S. 560–562). Kiel: IPN.
PDF icon Peschel, Carell (2013). Forschendes Lernen im Web 2.0 - kidipedia.pdf (785.23 KB)
Peschel, M., Köster, H., & Zimmermann, M.. (2013). Forschendes Lernen in der Frühpädagogik und im Sachunterricht. In S. Bernhold (Hrsg.), Inquiry-based learning – Forschendes Lernen. Gesellschaft für Didaktik der Chemie und Physik, Jahrestagung in Hannover 2012. (Bd. 33, S. 542-544). Kiel: IPN.
PDF icon Peschel, Köster, Zimmermann (2013). Forschendes Lernen in der Frühpädagogik und im Sachunterricht.pdf (693.6 KB)
Peschel, M. (2013). GOFEX – Ort des Lehrens und Lernens. In E. Wannack, Bosshart, S., Eichenberger, A., Fuchs, M., Hardegger, E., & Marti, S. (Hrsg.), 4-12-jährige – Ihre schulischen und außerschulischen Lern- und Lebenswelten (S. 260-268). Münster: Waxmann Verlag.
PDF icon Peschel, M. (2013) GOFEX - Ort des Lehrens und Lernens.pdf (1.81 MB)
Peschel, M., & Schumacher, A.. (2013). Grundschullabor für Offenes Experimentieren – Lehr- und Lernort für Schülerinnen und Schüler, Studierende und Lehrpersonen. In H. Coelen & Müller-Naendrup, B. (Hrsg.), Studieren in Lernwerkstätten. Potentiale und Herausforderungen für die Lehrerbildung (S. 85-91). Wiesbaden: Springer VS. doi:10.1007/978-3-658-00315-9_7
PDF icon Peschel & Schumacher (2013) - Grundschullabor für Offenes Experimentieren.pdf (1.23 MB)
Peschel, M. (2013). Gute Aufgaben für forschendes Lernen im experimentierenden Sachunterricht. In S. Bernholt (Hrsg.), Inquiry-based learning – Forschendes Lernen. Gesellschaft für Didaktik der Chemie und Physik, Jahrestagung Hannover 2012 (Bd. 33, S. 128-130). Kiel: IPN.
PDF icon Peschel (2013). Gute Aufgaben für Forschendes Lernen im experimentierenden Sachunterricht.pdf (697.91 KB)
Gervé, F., & Peschel, M.. (2013). Medien im Sachunterricht. In E. Gläser & Schönknecht, G. (Hrsg.), Sachunterricht in der Grundschule (S. 58-79). Frankfurt a. M.: Arbeitskreis Grundschule – Der Grundschulverband.
Peschel, M. (2013). Perspektivenvernetzender Themenbereich Medien. In Perspektivrahmen Sachunterricht (S. 83–85). Bad Heilbrunn: Verlag Julius Klinkhardt.
Schröder, C.. (2013). Politische Umbrüche und Soziale Arbeit in der Maghreb-Maschrek-Region. In Weltatlas Sozialen Arbeit – Jenseits aller Vermessungen (S. 32-51). Weinheim: Beltz Juventa Verlag.
Schröder, C.. (2013). Quién define lo que es el FSM? . In (Foro Social Mundial: ¿Momento de replanteamientos?).
PDF icon Online verfügbar unter http://www.alainet.org/publica/alai484w.pdf (861.14 KB)
Peschel, M., Favre, P., & Mathis, C.. (2013). Sachunterricht im Wandel. In M. Peschel, Favre, P., & Mathis, C. (Hrsg.), SaCHen unterriCHten – Beiträge zur Situation der Sachunterrichtsdidaktik in der deutschsprachigen Schweiz (Bd. 6, Dimensionen des Sachunterrichts – Kinder.Sachen.Welten, S. 7-20). Baltmannsweiler: Schneider Verlag Hohengehren.
Mathis, C., & Peschel, M.. (2013). Sachunterrichtsstudium für die Vorschul-/Primarstufe an der Pädagogischen Hochschule FHNW. In M. Peschel, Favre, P., & Mathis, C. (Hrsg.), SaCHen unterriCHten – Beiträge zur Situation der Sachunterrichtsdidaktik in der deutschsprachigen Schweiz (Bd. 6, Dimensionen des Sachunterrichts – Kinder.Sachen.Welten, S. 67-82). Baltmannsweiler: Schneider Verlag Hohengehren.
Czepukojc, B., Baltes, A. - K., Cerella, C., Kelkel, M., Viswanathan, U. Maheswari, Salm, F., u. a.. (2013). Synthetic polysulfane derivatives induce cell cycle arrest and apoptotic cell death in human hematopoietic cancer cells. In Food and chemical toxicology: an international journal published for the British Industrial Biological Research Association 64.
PDF icon Synthetic polysulfane derivatives induce cell cycle arrest and apoptotic cell death in human hematopoietic cancer cells (1.23 MB)
Schröder, C., & Homfeldt, H. Günther. (2013). Transnationales Wissen in NGOs. In Transnationales Wissen und Soziale Arbeit. Weinheim: Beltz Juventa Verlag.
Peschel, M. (2013). Vergleichen und Recherchieren. In (Hrsg.), Perspektivrahmen Sachunterricht (S. 148–152). Bad Heilbrunn: Verlag Julius Klinkhardt.
Schröder, C.. (2013). Who defines what the World Social Forum is?. In (Foro Social Mundial: ¿Momento de replanteamientos?).
PDF icon Online verfügbar unter http://www.alainet.org/active/63553 (128.25 KB)
2012
PDF icon Peschel (2012) Geldautomat.PDF (624.31 KB)
Carell, S., & Peschel, M.. (2012). Die Internetplattform kidipedia im Unterricht sinnvoll nutzen. In " GDSU" (Hrsg.), GDSU-Journal (Bd. 2, S. 57-66).
PDF icon Peschel, Carell (2012). Die Internetplattform kidipedia im Unterricht sinnvoll nutzen.pdf (136.3 KB)
Peschel, M. (2012). Gute Aufgaben im Sachunterricht – Offene Werkstätten = Gute Aufgaben?. In U. Carle & Kosinar, J. (Hrsg.), Aufgabenqualität in der Grundschule (S. 161-172). Baltmannsweiler: Schneider Verlag Hohengehren.
PDF icon Peschel, M. (2012) Gute Aufgaben im Sachunterricht.pdf (1.84 MB)
Peschel, M., & Carell, S.. (2012). Kidipedia – Unterstützungsangebot für Mädchen & Jungen im Sachunterricht. In S. Bernholt (Hrsg.), Konzepte fachdidaktischer Strukturierung für den Unterricht (Bd. 32, S. S. 464-467). Münster: LIT Verlag.
PDF icon Peschel (2012). Mediendidaktik, Medienkompetenz, Medienerziehung - Web 2.0 Aktivitäten im Sachunterricht.pdf (86.21 KB)
Peschel, M., & Schumacher, A.. (2012). Neue Wege beim Experimentieren. Schulblatt der Kantone Aargau und Solothurn.
Peschel, M., & Streit, C.. (2012). Physik und Mathe können lustvoll gelernt werden. Bildungsseite der Aargauer Zeitung und der Basler Zeitung.
PDF icon Kelkel, Cerella, Mack, Schneider, Jacob, Schumacher, Diacto, Diederich (2012). ROS-independent JNK activation and multisite phosphorylation of Bcl-2 link diallyl tetrasulfide-induced mitotic arrest to apoptosis.pdf (2.44 MB)
2011
Kelkel, M., Schumacher, M., Dicato, M., & Diederich, M. F.. (2011). Antioxidant and anti-proliferative properties of lycopene. In Free Radical Research (8. Aufl., Bd. 45, S. 925-940). doi: 10.3109/10715762.2011.564168
PDF icon Kelkel, Schumacher, Dicato, Diederich (2011). Antioxidant and anti-proliferative properties of lycopene.pdf (447.21 KB)
Peschel, M. (2011). Der Lernstick und die Schulfächer – Versuch einer Übersicht. In H. - U. Grunder (Hrsg.), mLearning in der Schule. Der Lernstick als Lerninstrument (S. 51-72). Baltmannsweiler: Schneider Verlag Hohengehren.
PDF icon Schumacher, Kelkel, Dicato, Diederich (2011).Gold from the sea: Marine compounds as inhibitors of the hallmarks of cancer.pdf (1.92 MB)
Peschel, M. (2011). kidipedia – Ein Onlinelexikon von Kids für Kids. In H. Giest, Kaiser, A., & Schomaker, C. (Hrsg.), Sachunterricht – auf dem Weg zur Inklusion (Bd. 21, Probleme und Perspektiven des Sachunterrichts, S. 193-198). Bad Heilbrunn: Verlag Julius Klinkhardt.
PDF icon Peschel (2011). kidipedia - Ein Onlinelexikon von Kids für Kids.pdf (373.11 KB)
Peschel, M., & Streit, C.. (2011). Lern-Atelier in Solothurn eröffnet. Schulblatt der Kantone Aargau und Solothurn.
Peschel, M. (2011). Macht der Mond die Nacht? – Tag und Nacht im Kindergarten. In Weltwissen Sachunterricht (Bd. Heft 03/2011, S. 6-7). Braunschweig: Westermann Verlag. Abgerufen von https://www.erzieherin.de/files/paedagogischepraxis/8701103_peschel_mond.pdf
PDF icon Peschel, M.(2011). Macht der Mond die Nacht? (1.09 MB)
Peschel, M. (2011). Medienerziehung und schulische Sozialerziehung. In M. Limbourg & Steins, G. (Hrsg.), Sozialerziehung in der Schule (S. 451-474). Wiesbaden: VS Verlag für Sozialwissenschaften.
Schröder, C.. (2011). “Mit vereinten Kräften voran”. Social Development in einem Kooperationsprojekt einer transnationaeln NGO und einer loken NGO. In Soziale Arbeit als Entwicklungszusammenarbeit. Baltmannsweiler: Schneider Verlag Hohengehren.
PDF icon Cerella, Kelkel, Viry, Dicato, Jacob, Diederich (2011). Naturally Occurring Organic Sulfur Compounds: An Example of a Multitasking Class of Phytochemicals in Anti-Cancer Research..pdf (711.62 KB)
PDF icon Online verfügbar unter http://www.budrich-journals.de/index.php/tsr/article/view/5487/4628 (398.73 KB)
Schneider, T., Baldauf, A., Schneider, M., Burkholz, T., Kelkel, M., & Jacob, C.. (2011). Selective Antimicrobial Activity Associated with Sulfur Nanoparticles. In Journal of Biomedical Nanotechnology (3. Aufl., Bd. 7, S. 395405). doi:10.1166/jbn.2011.1293
PDF icon Schneider et al. (2011).Selective Antimicrobial Activity Associated with Sulfur Nanoparticles.pdf (1.28 MB)
PDF icon Schumacher, Kelkel, Dicato, Diederich (2011). A Survey of Marine Natural Compounds and Their Derivatives with Anti-Cancer Activity Reported in 2010.pdf (2.1 MB)
Peschel, M. (2011). Wege zum Offenen Experimentieren. (K. Scheler, Hrsg.)Wissenschaft trifft Praxis – Bericht von der Expertentagung zur frühen naturwissenschaftlichen Bildung, Forscherstation – Heidelberg, 48-54.
2010
PDF icon Decrypting the labyrinth of inflammatory cell signaling pathways.pdf (67.68 KB)
Peschel, M., Weißer, P., & Schäfer, J.. (2010). Der Zucker nimmt die Tinte Huckepack – Kooperationen zwischen Schule und Universität. In Sache – Wort – Zahl (SWZ) (Heft 112, 09/2010, 38. Jhg., S. 48-56). Hallbergmoos: Aulis Verlag.
PDF icon Peschel (2010) Der Zucker nimmt die Tinte Huckepack.PDF (1.55 MB)
Peschel, M., & Struzyna, S.. (2010). GOFEX – Grundschullabor für Offenes Experimentieren: Entwicklung eines Raumkonzeptes als Element der Öffnung. In K. - H. Arnold, Hauenschild, K., Schmidt, B., & Ziegenmeyer, B. (Hrsg.), Zwischen Fachdidaktik und Stufendidaktik. Perspektiven für die Grundschulforschung (Bd. 14, Jahrbuch Grundschulforschung, S. 197-200). Wiesbaden: VS Verlag für Sozialwissenschaften.
PDF icon Peschel, M., Struzyna, S. (2010). GOFEX : Entwicklung eines Raumkonzeptes als Element der Öffnung (1.52 MB)
Peschel, M., & Carell, S.. (2010). Grundschullabor für Offenes Experimentieren. Das Materialkonzept.. In D. Höttecke (Hrsg.), Entwicklung naturwissenschaftlichen Denkens zwischen Phänomen und Systematik (Bd. 30, S. 461-463). Münster: LIT Verlag.
PDF icon PeschelCarell (2010) Das Materialkonzept.pdf (5.36 MB)
Peschel, M. (2010). Grundschullabor für Offenes Experimentieren – Grundschultransfer?. In H. Giest & Pech, D. (Hrsg.), Anschlussfähige Bildung im Sachunterricht (Bd. 20, Probleme und Perspektiven des Sachunterrichts, S. 49-57). Bad Heilbrunn: Verlag Julius Klinkhardt.
PDF icon Peschel. M. (2010) GOFEX - Grundschultransfer?.pdf (9.28 MB)
Peschel, M. (2010). kidipedia – Präsentieren von Sachunterrichtsergebnissen im Internet. In M. Peschel (Hrsg.), Neue Medien im Sachunterricht (S. 71-78). Baltmannsweiler: Schneider Verlag Hohengehren.
PDF icon Peschel (2010) kidipedia - Präsentieren von Sachunterrichtsergebnissen im Internet.pdf (706.07 KB)
Peschel, M. (2010). kidipedia – Untersuchung der Machbarkeit einer neuartigen Online-Plattform. Arbeitspapiere der Hans-Böckler-Stiftung (Bd. 190). Düsseldorf: Setzkasten. Abgerufen von https://www.boeckler.de/5137.htm?produkt=HBS-004759&chunk=2&jahr=
PDF icon Peschel (2010).kidipedia-Untersuchung der Machbarkeit einer neuartigen Onlineplattform .pdf (4.34 MB)
Peschel, M. (2010). kidipedia.de – Eine Präsentationsplattform im Internet für Sachunterrichtsergebnisse. In K. - H. Arnold, Hauenschild, K., Schmidt, B., & Ziegenmeyer, B. (Hrsg.), Zwischen Fachdidaktik und Stufendidaktik. Perspektiven für die Grundschulforschung (Bd. 14, Jahrbuch Grundschulforschung, S. 193-196). Wiesbaden: VS Verlag für Sozialwissenschaften.
Peschel, M., & Struzyna, S.. (2010). Konzeption eines Grundschullabors für Offenes Experimentieren (GOFEX). Der Raum als Element der Öffnung.. In D. Höttecke (Hrsg.), Entwicklung naturwissenschaftlichen Denkens zwischen Phänomen und Systematik (Bd. 30, S. 458-460). Münster: LIT Verlag.
PDF icon PeschelStruzyna (2010) GOFEX - Der Raum als Element der Öffnung.pdf (4.36 MB)
Peschel, M. (2010). Luft und Vakuum. Experimente mit Luft .. und ohne!. In Sache – Wort – Zahl (SWZ) (Bd. Heft 108, 03/2010, 38. Jhg., S. 23-25). Hallbergmoos: Aulis Verlag.
PDF icon Peschel (2010) Luft und Vakuum.PDF (748.87 KB)
Peschel, M., & Herrmann, C.. (2010). Materialaspekt im Sachunterricht – Einflüsse des Materials auf die physikalischen Anteile des Sachunterrichts. In D. Höttecke (Hrsg.), Entwicklung naturwissenschaftlichen Denkens zwischen Phänomen und Systematik (Bd. 30, S. 455-457). Münster: LIT Verlag.
Peschel, M. (2010). Neue Medien im Sachunterricht. Gestern – Heute – Morgen. Baltmannsweiler: Schneider Verlag Hohengehren.
PDF icon Peschel (2010).Neue Medien in Forschung und Praxis. Ergebnisse aus der Arbeitsgruppe AG Neue Medien (ICT) im Sachunterricht GDSU.PDF (228.35 KB)
Peschel, M., & Carell, S.. (2010). Nutzungsweise computergestützter Medien – Unterschiede zwischen Jungen und Mädchen?!. In Neue Medien im Sachunterricht (S. 79-86). Baltmannsweiler: Schneider Verlag Hohengehren.
PDF icon Kelkel, Jacob, Dicato, Diederich (2010).Potential of the Dietary Antioxidants Resveratrol and Curcumin in Prevention and Treatment of Hematologic Malignancies.pdf (792.79 KB)
2009
Peschel, M. (2009). Alleine geht es gut, zusammen manchmal besser! – Kooperationen im Sachunterricht beim Experimentieren. In Sache – Wort – Zahl (SWZ) (Bd. Heft 101, 04/2009, 37 Jhg., S. 23-27). Hallbergmoos: Aulis Verlag.
PDF icon Peschel, M. (2009). Alleine geht es gut, zusammen manchmal besser!.pdf (7.55 MB)
Peschel, M. (2009). Aus- und Fortbildungen für den naturwissenschaftlich-physikalischen Sachunterricht. In R. Lauterbach, Giest, H., & Marquardt-Mau, B. (Hrsg.), Lernen und kindliche Entwicklung (Bd. 19, Probleme und Perspektiven des Sachunterrichts, S. 149-156). Bad Heilbrunn: Verlag Julius Klinkhardt.
Peschel, M. (2009). Der Begriff der Offenheit beim Offenen Experimentieren. In D. Höttecke (Hrsg.), Chemie- und Physikdidaktik für die Lehramtsausbildung (S. 268-270). Münster: LIT Verlag.
PDF icon Peschel (2009) Der Begriff der Offenheit beim Offenen Experimentieren.pdf (3.82 MB)
Peschel, M. (2009). GOFEX – Grundschullabor für Offenes Experimentieren. Grundlegende Konzeption. In R. Lauterbach, Giest, H., & Marquardt-Mau, B. (Hrsg.), Lernen und kindliche Entwicklung (Bd. 19, Probleme und Perspektiven des Sachunterrichts, S. 229-236). Bad Heilbrunn: Verlag Julius Klinkhardt.
PDF icon Peschel (2009) GOFEX. Grundlegende Konzeption.pdf (528.97 KB)
Peschel, M. (2009). Naturwissenschaftliche Aus- und Fortbildung für den Sachunterricht – Ergebnisse aus dem Projekt SUN zum physikbezogenen Sachunterricht. In D. Höttecke (Hrsg.), Chemie- und Physikdidaktik für die Lehramtsausbildung (S. 143-145). Münster: LIT Verlag.
Peschel, M., & Giest, H.. (2009). Spielen am Computer – Chancen für den Sachunterricht. In Grundschulunterricht – Sachunterricht (Bd. 02/2009, S. 33-37). München: Oldenbourg Verlag.
PDF icon Peschel, M., Giest, H. (2009). Spielen am Computer-Chancen für den Sachunterricht (989.62 KB)
Peschel, M., & Bürger, C.. (2009). Unterrichtsbedingungen für physikalischen Sachunterricht (SUN). In D. Höttecke (Hrsg.), Chemie- und Physikdidaktik für die Lehramtsausbildung (S. 428-430). Münster: LIT Verlag.
2008
Peschel, M. (2008). GOFEX – Grundschullabor für Offenes Experimentieren. In Didaktik der Physik. Berlin: Lehmanns Media.
Peschel, M. (2008). kidipedia – Ein Wikipedia für Kids. Zentrum für Lehrerbildung Essen: Fachdidaktische Forschung – Empirische Lehr-Lern-Forschung, 70-72.
Peschel, M. (2008). Offenes Experimentieren – Chancen für Jungen und Mädchen!. In J. Ramsberger & Ramsberger, W. (Hrsg.), Chancengleichheit in der Grundschule. Ursachen und Wege aus der Krise (Bd. 12, Jahrbuch Grundschulforschung). Wiesbaden: VS Verlag für Sozialwissenschaften.
PDF icon Peschel, M. (2008) Offenes Experimentieren - Eine Chance für Jungen und Mädchen.pdf (88.68 KB)
Peschel, M. (2008). Schriftanlässe – Kommunikation im Schriftspracherwerb. In Grundschule Deutsch (Bd. 02/2008). München: Oldenbourg Verlag.
PDF icon Peschel, M. (2008). Schriftanlässe. Kommunikation im Schriftspracherwerb..pdf (5.57 MB)
Peschel, M. (2008). SUN: Erhebung der Lehrvoraussetzungen und des Professionswissens von Lehrenden im Sachunterricht der Grundschule. Zentrum für Lehrerbildung Essen: Fachdidaktische Forschung – Empirische Lehr-Lern-Forschung, 68-70.
2007
Peschel, M. (2007). Konzeption einer Studie zu den Lehrvoraussetzungen und dem Professionswissen von Lehrenden im Sachunterricht der Grundschule in NRW. Das Projekt SUN. In R. Lauterbach, Hartinger, A., Feige, B., & Cech, D. (Hrsg.), Kompetenzerwerb im Sachunterricht fördern und erfassen (Bd. 17, Probleme und Perspektiven des Sachunterrichts, S. 151-160). Bad Heilbrunn: Verlag Julius Klinkhardt.
PDF icon Peschel,M. (2007). Konzeption einer Studie zu den Lehrvoraussetzungen und dem Professionswissen von Lehrenden im Sachunterricht der Grundschule in NRW. Das Projekt SUN..pdf (713.99 KB)
Peschel, M., & Struzyna, S.. (2007). Wer unterrichtet unsere Kinder? SUN – Sachunterricht in Nordrhein-Westfalen. In K. möller, Hanke, P., Beinbrech, C., Hein, A., Kleickmann, T., & Schages, R. (Hrsg.), Qualität von Grundschulunterricht entwickeln, erfassen und bewerten (Bd. 11, Jahrbuch Grundschulforschung, S. 171-174). Bonn: Verlag für Sozialwissenschaften.
PDF icon Peschel, M., Struzyna, S. (2007). Wer unterrichtet unserer Kinder? (111.99 KB)
2006
Peschel, M. (2006). Das Mobile Computerlabor. Konzeption und Anwendungen. In V. Nordmeier & Oberländer, A. (Hrsg.), Didaktik der Physik Kassel. Berlin: Lehmanns Media.
Peschel, M. (2006). Der Computer zur Präsentation von Experimenten im Sachunterricht. In Zeitschrift Grundschulunterricht (Bd. 05/2006, S. S. 31-34). München: Oldenbourg Verlag.
Peschel, M. (2006). LDS im Werkstattunterricht. Defintion und Abgrenzung. In R. Hinz & Pütz, T. (Hrsg.), Professionelles Handeln in der Grundschule (Entwicklungslinien der Grundschulpädagogik., Bd. 3, S. 159-166). Baltmannsweiler: Schneider Verlag Hohengehren.
Peschel, M. (2006). Lehrvoraussetzungen und Professionswissen von Lehrenden im Sachunterricht der Grundschule. (A. Pitton, Hrsg.)Fachdidaktische Forschung – Empirische Lehr-Lern-Forschung. Essen, 88 ff.
Peschel, M. (2006). Sachunterricht und Lautorientierter Schriftspracherwerb. In R. Hinz & Schumacher, B. (Hrsg.), Auf den Anfang kommt es an: Kompetenzen entwickeln – Kompetenzen stärken (S. S. 67-76). Wiesbaden: VS Verlag für Sozialwissenschaften. Abgerufen von https://link.springer.com/content/pdf/10.1007%2F978-3-531-90429-0_7.pdf
PDF icon Peschel (2006). Sachunterricht und Lautorientierter Schriftspracherwerb.pdf (150.25 KB)
2005
Peschel, M. (2005). Lernchance Computer?. Tagungsband der Hans-Böckler-Stiftung.
2003
Peschel, M. (2003). Die "Dichterlesung". Ein Element der schriftlichen Kommunikation beim Schriftspracherwerb mit "Lesen durch Schreiben". In A. Panagiotopoulou & Brügelmann, H. (Hrsg.), Grundschulpädagogik meets Kindheitsforschung. Zum Wechselverständnis von schulischem Lernen und außerschulischen Erfahrungen im Grundschulalter (Jahrbuch Grundschulforschung., S. 145-149). Opladen: Leske + Budrich Verlag.

Projekte im Fokus

Das Dachprojekt Digitale Grundschule (www.grundschule-digital.de) bündelt und organisiert die...

Projekte im Fokus

Übergeordnetes Ziel des Projektes QUANTAG („Quanten im Alltag") ist es, einer möglichst breiten...
Go to top